Structure of PDB 2xs4 Chain A Binding Site BS01

Receptor Information

>2xs4 Chain A (length=167) Species: 28112 (Tannerella forsythia)

YVLQGSKWNKTTLKYYIYNSSSHLTTTERENAIRSAFALWSDKSTLSFIQ
VYNPNQADIKIKWEKGNHGDGYPFDGNTGILAHAFYPPPAGGNYAGHLHF
DDDENWSINGSGIDLITVAAHEIGHLLGIEHSNVSSALMYPYYTGIKRQL
DNDDCLAVWDLYGYPFS

Ligand information

>2xs4 Chain B (length=3) Species: 32630 (synthetic construct)

AFT

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2xs4 The Structure of the Catalytic Domain of Tannerella Forsythia Karilysin Reveals It is a Bacterial Xenologue of Animal Matrix Metalloproteinases.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): H155 E156 H159 H165 P175 Y176
• Binding residue (residue number reindexed from 1): H121 E122 H125 H131 P141 Y142

Enzymatic activity

• Catalytic site (original residue number in PDB): H155 E156 H159 H165
• Catalytic site (residue number reindexed from 1): H121 E122 H125 H131
• Enzyme Commision number: 3.4.24.-

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:2xs4, PDBe:2xs4, PDBj:2xs4
• PDBsum: 2xs4
• PubMed: 21166898
• UniProt: D0EM77|KLY_TANFA Karilysin (Gene Name=kly)