Structure of PDB 2g4b Chain A Binding Site BS01

Receptor Information
>2g4b Chain A (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQD
KNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIG
GLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTD
QAIAGLNGMQLGDKKLLVQRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g4b Structural basis of polypyrimidine tract recognition by the essential splicing factor U2AF65.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R150 Y152 K195 N196 F199 K225 R227 P229 H230 D231
Binding residue
(residue number reindexed from 1)		R6 Y8 K51 N52 F55 K81 R83 P85 H86 D87
Binding affinityPDBbind-CN: Kd=1.8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2g4b, PDBe:2g4b, PDBj:2g4b
PDBsum2g4b
PubMed16818232
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]