Structure of PDB 1nu2 Chain A Binding Site BS01

Receptor Information

>1nu2 Chain A (length=152) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVV
AGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITD
HRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEK
KA

Ligand information

>1nu2 Chain B (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NFDNPVYRKT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nu2 Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R56 V110 H111 I113 S114 Y115 I116 A117 G131 K132 I151 R155 F158 Y162
Binding residue (residue number reindexed from 1)	R34 V88 H89 I91 S92 Y93 I94 A95 G109 K110 I129 R133 F136 Y140

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1nu2, PDBe:1nu2, PDBj:1nu2
PDBsum	1nu2
PubMed	12737822
UniProt	P97318\|DAB1_MOUSE Disabled homolog 1 (Gene Name=Dab1)

[Back to BioLiP]