Structure of PDB 1jbr Chain A Binding Site BS01

Receptor Information
>1jbr Chain A (length=149) Species: 5064 (Aspergillus restrictus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHW
FTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFP
DGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jbr Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Y47 H49 W50 F51 T52 N53 R65 K110 K111 K113 D143
Binding residue
(residue number reindexed from 1)		Y47 H49 W50 F51 T52 N53 R65 K110 K111 K113 D143
Binding affinityPDBbind-CN: Kd=1uM
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004518 nuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
Biological Process
GO:0017148 negative regulation of translation
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jbr, PDBe:1jbr, PDBj:1jbr
PDBsum1jbr
PubMed11685244
UniProtP67876|RNMG_ASPRE Ribonuclease mitogillin (Gene Name=ret)

[Back to BioLiP]