Structure of PDB 5aka Chain 5 Binding Site BS01

Receptor Information
>5aka Chain 5 (length=109) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMM
KKMKKGGMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aka Ribosome-Srp-Ftsy Cotranslational Targeting Complex in the Closed State.
Resolution5.7 Å
Binding residue
(original residue number in PDB)		L350 K365 M423 M426
Binding residue
(residue number reindexed from 1)		L23 K38 M96 M99
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5aka, PDBe:5aka, PDBj:5aka
PDBsum5aka
PubMed25775537
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]