bzip2: Can't open input file rep*.tra: No such file or directory.
Posted: Sat May 20, 2023 7:47 am
$ sudo perl /mnt/c/I-TASSER5.1/I-TASSERmod/runI-TASSER.pl -libdir /home/user/ITLIB -seqname seq -datadir /mnt/c/I-TASSER5.1/example -datadir /mnt/c/I-TASSER5.1/example
Your setting for running I-TASSER is:
-pkgdir = /mnt/c/I-TASSER5.1
-libdir = /home/user/ITLIB
-java_home = /usr
-seqname = seq
-datadir = /mnt/c/I-TASSER5.1/example
-outdir = /mnt/c/I-TASSER5.1/example
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> seq
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Secondary structure prediction was done before.
2.3 Predict solvent accessibility...
2.4 run pairmod
pair exist
3.1 do threading
/mnt/c/I-TASSER5.1/example/init.PPAS exists
/mnt/c/I-TASSER5.1/example/init.dPPAS exists
/mnt/c/I-TASSER5.1/example/init.dPPAS2 exists
/mnt/c/I-TASSER5.1/example/init.Env-PPAS exists
start serial threading MUSTER
/tmp/root/ITseq
/mnt/c/I-TASSER5.1/example/MUSTER_seq
Illegal division by zero at /mnt/c/I-TASSER5.1/example/MUSTER_seq line 599.
hostname: STATION-PCMC
starting time: Sat May 20 09:34:01 CEST 2023
pwd: /tmp/root/ITseq
running Psi-blast .....
running zalign .....
/mnt/c/I-TASSER5.1/example/init.wPPAS exists
/mnt/c/I-TASSER5.1/example/init.wdPPAS exists
/mnt/c/I-TASSER5.1/example/init.wMUSTER exists
3.2 make restraints
4.1 run simulation
run 14 serial simulations
run simulation job 1 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 2 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 3 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 4 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 5 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 6 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 7 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 8 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 9 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 10 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 11 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 12 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 13 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 14 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
5.1 do clustering
No. of trajectory files: 0
Your setting for running I-TASSER is:
-pkgdir = /mnt/c/I-TASSER5.1
-libdir = /home/user/ITLIB
-java_home = /usr
-seqname = seq
-datadir = /mnt/c/I-TASSER5.1/example
-outdir = /mnt/c/I-TASSER5.1/example
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> seq
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Secondary structure prediction was done before.
2.3 Predict solvent accessibility...
2.4 run pairmod
pair exist
3.1 do threading
/mnt/c/I-TASSER5.1/example/init.PPAS exists
/mnt/c/I-TASSER5.1/example/init.dPPAS exists
/mnt/c/I-TASSER5.1/example/init.dPPAS2 exists
/mnt/c/I-TASSER5.1/example/init.Env-PPAS exists
start serial threading MUSTER
/tmp/root/ITseq
/mnt/c/I-TASSER5.1/example/MUSTER_seq
Illegal division by zero at /mnt/c/I-TASSER5.1/example/MUSTER_seq line 599.
hostname: STATION-PCMC
starting time: Sat May 20 09:34:01 CEST 2023
pwd: /tmp/root/ITseq
running Psi-blast .....
running zalign .....
/mnt/c/I-TASSER5.1/example/init.wPPAS exists
/mnt/c/I-TASSER5.1/example/init.wdPPAS exists
/mnt/c/I-TASSER5.1/example/init.wMUSTER exists
3.2 make restraints
4.1 run simulation
run 14 serial simulations
run simulation job 1 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 2 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 3 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 4 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 5 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 6 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 7 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 8 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 9 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 10 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 11 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 12 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 13 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
run simulation job 14 / 14
bzip2: Can't open input file rep*.tra: No such file or directory.
5.1 do clustering
No. of trajectory files: 0