error when running i-tasser
Posted: Wed Jul 07, 2021 4:38 am
Hi, I've encountered an error when running i-tasser which says that the length of my sequence is not within the range even though the sequence is only around 70 residues. What do you think might be the problem?
Here's what I've wrote:
user@LamSD:~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/us
er/Desktop/fatin/I-TASSER5.1/ITLIB -seqname LAN_01_018,1.10.20.10-FF-000011,564-639 -
datadir /home/user/Desktop/fatin/I-TASSER5.1 -outdir /home/user/Desktop/fatin/I-TASSE
R5.1
Your setting for running I-TASSER is:
-pkgdir = /home/user/Desktop/fatin/I-TASSER5.1
-libdir = /home/user/Desktop/fatin/I-TASSER5.1/ITLIB
-java_home = /usr
-seqname = LAN_01_018,1.10.20.10-FF-000011,564-639
-datadir = /home/user/Desktop/fatin/I-TASSER5.1
-outdir = /home/user/Desktop/fatin/I-TASSER5.1
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
error: the sequence length is not in the range [10, 1500]
The sequence:
>LAN_01_018,1.10.20.10-FF-000011,564-639
SKGRTASKRKIRELVESVDPEERLNDEVEDLLLEIADEFIDSITRFGCQLAKHRKSDRLEVKDLALHLERSYGMRI
Here's what I've wrote:
user@LamSD:~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/us
er/Desktop/fatin/I-TASSER5.1/ITLIB -seqname LAN_01_018,1.10.20.10-FF-000011,564-639 -
datadir /home/user/Desktop/fatin/I-TASSER5.1 -outdir /home/user/Desktop/fatin/I-TASSE
R5.1
Your setting for running I-TASSER is:
-pkgdir = /home/user/Desktop/fatin/I-TASSER5.1
-libdir = /home/user/Desktop/fatin/I-TASSER5.1/ITLIB
-java_home = /usr
-seqname = LAN_01_018,1.10.20.10-FF-000011,564-639
-datadir = /home/user/Desktop/fatin/I-TASSER5.1
-outdir = /home/user/Desktop/fatin/I-TASSER5.1
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
error: the sequence length is not in the range [10, 1500]
The sequence:
>LAN_01_018,1.10.20.10-FF-000011,564-639
SKGRTASKRKIRELVESVDPEERLNDEVEDLLLEIADEFIDSITRFGCQLAKHRKSDRLEVKDLALHLERSYGMRI