Zhanglab forum

Hi, I've encountered an error when running i-tasser which says that the length of my sequence is not within the range even though the sequence is only around 70 residues. What do you think might be the problem?

Here's what I've wrote:
user@LamSD:~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/us
er/Desktop/fatin/I-TASSER5.1/ITLIB -seqname LAN_01_018,1.10.20.10-FF-000011,564-639 -
datadir /home/user/Desktop/fatin/I-TASSER5.1 -outdir /home/user/Desktop/fatin/I-TASSE
R5.1

Your setting for running I-TASSER is:
-pkgdir = /home/user/Desktop/fatin/I-TASSER5.1
-libdir = /home/user/Desktop/fatin/I-TASSER5.1/ITLIB
-java_home = /usr
-seqname = LAN_01_018,1.10.20.10-FF-000011,564-639
-datadir = /home/user/Desktop/fatin/I-TASSER5.1
-outdir = /home/user/Desktop/fatin/I-TASSER5.1
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false

1. make seq.txt and rmsinp
error: the sequence length is not in the range [10, 1500]

The sequence:
>LAN_01_018,1.10.20.10-FF-000011,564-639
SKGRTASKRKIRELVESVDPEERLNDEVEDLLLEIADEFIDSITRFGCQLAKHRKSDRLEVKDLALHLERSYGMRI

can you attach you sequence here? we can not find problem from the pasted sequence, Than you.

sure! here's the sequence

Can you make a folder that named as "Test" or others instead of "LAN_01_018,1.10.20.10-FF-000011,564-639" and put you sequence in that folder, rename the sequence file as seq.fasta, do not just put LAN_01_018,1.10.20.10-FF-000011,564-639 into the folder, I am not sure the problem is caused by the path that contains "," or you didn't put the seq.fasta file in the folder, but you can try first.

From the sequence itself, seems no problem, let me know if it works or not

also, when you do like what said, then run commands like the following

~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/user/Desktop/fatin/I-TASSER5.1/ITLIB -seqname Test -datadir /home/user/Desktop/fatin/I-TASSER5.1/Test -outdir /home/user/Desktop/fatin/I-TASSER5.1/Test

if your folder named as Test

It worked! Thank you so much for your help.

The error message indicates that I-TASSER is having trouble recognizing your input sequence length,fireboy and watergirl which it claims is outside the acceptable range of 10 to 1500 residues. However, your sequence is only about 70 residues long, which is within this range.

If you still have difficulties, please refer to I-TASSER's detailed manual or join the online forums for support from the user community. aa route planner