error when running i-tasser

Ask, share, and solve problems with our support team.
fatin_izz
Posts: 4
Joined: Fri Jun 11, 2021 4:44 am

error when running i-tasser

Post by fatin_izz »

Hi, I've encountered an error when running i-tasser which says that the length of my sequence is not within the range even though the sequence is only around 70 residues. What do you think might be the problem?

Here's what I've wrote:
user@LamSD:~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/us
er/Desktop/fatin/I-TASSER5.1/ITLIB -seqname LAN_01_018,1.10.20.10-FF-000011,564-639 -
datadir /home/user/Desktop/fatin/I-TASSER5.1 -outdir /home/user/Desktop/fatin/I-TASSE
R5.1

Your setting for running I-TASSER is:
-pkgdir = /home/user/Desktop/fatin/I-TASSER5.1
-libdir = /home/user/Desktop/fatin/I-TASSER5.1/ITLIB
-java_home = /usr
-seqname = LAN_01_018,1.10.20.10-FF-000011,564-639
-datadir = /home/user/Desktop/fatin/I-TASSER5.1
-outdir = /home/user/Desktop/fatin/I-TASSER5.1
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false

1. make seq.txt and rmsinp
error: the sequence length is not in the range [10, 1500]

The sequence:
>LAN_01_018,1.10.20.10-FF-000011,564-639
SKGRTASKRKIRELVESVDPEERLNDEVEDLLLEIADEFIDSITRFGCQLAKHRKSDRLEVKDLALHLERSYGMRI
jlspzw
Posts: 246
Joined: Tue May 04, 2021 5:04 pm

Re: error when running i-tasser

Post by jlspzw »

can you attach you sequence here? we can not find problem from the pasted sequence, Than you.
fatin_izz
Posts: 4
Joined: Fri Jun 11, 2021 4:44 am

Re: error when running i-tasser

Post by fatin_izz »

sure! here's the sequence
Attachments
LAN_01_018.zip
(359 Bytes) Downloaded 930 times
jlspzw
Posts: 246
Joined: Tue May 04, 2021 5:04 pm

Re: error when running i-tasser

Post by jlspzw »

Can you make a folder that named as "Test" or others instead of "LAN_01_018,1.10.20.10-FF-000011,564-639" and put you sequence in that folder, rename the sequence file as seq.fasta, do not just put LAN_01_018,1.10.20.10-FF-000011,564-639 into the folder, I am not sure the problem is caused by the path that contains "," or you didn't put the seq.fasta file in the folder, but you can try first.

From the sequence itself, seems no problem, let me know if it works or not
jlspzw
Posts: 246
Joined: Tue May 04, 2021 5:04 pm

Re: error when running i-tasser

Post by jlspzw »

also, when you do like what said, then run commands like the following

~/Desktop/fatin/I-TASSER5.1/I-TASSERmod$ ./runI-TASSER.pl -libdir /home/user/Desktop/fatin/I-TASSER5.1/ITLIB -seqname Test -datadir /home/user/Desktop/fatin/I-TASSER5.1/Test -outdir /home/user/Desktop/fatin/I-TASSER5.1/Test

if your folder named as Test
fatin_izz
Posts: 4
Joined: Fri Jun 11, 2021 4:44 am

Re: error when running i-tasser

Post by fatin_izz »

It worked! Thank you so much for your help.
matumbrella
Posts: 3
Joined: Wed Sep 11, 2024 8:48 am

Re: error when running i-tasser

Post by matumbrella »

The error message indicates that I-TASSER is having trouble recognizing your input sequence length,fireboy and watergirl which it claims is outside the acceptable range of 10 to 1500 residues. However, your sequence is only about 70 residues long, which is within this range.
emmausa
Posts: 2
Joined: Tue Oct 22, 2024 1:46 am

Re: error when running i-tasser

Post by emmausa »

If you still have difficulties, please refer to I-TASSER's detailed manual or join the online forums for support from the user community. aa route planner
Post Reply