TripletRes result for job TRC626

User Input

>Example (75 residues)
ILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAY
AALAALEKLFPDTPL

TripletRes Contact Prediction

The above plot displays the top-2*L (150) all-range (short, medium, and long-range) predicted contacts sorted by TripletRes confidence score.
The full-length contact information for all residue pairs can be downloaded here in CASP RR format:

#CASP RR format
i j d1 d2 p

-i j:   indices of the two residues.
-d1 d2:  the distance limits defining a contact, typically d1=0 and d2=8.
-p:    TripletRes confidence score, indicating probability of the two residues being in contact.

Download contact map.

Reference:

Yang Li, Chengxin Zhang, Eric W Bell, Wei Zheng, Dongjun Yu, Yang Zhang. Deducing high-accuracy protein contact-maps from a triplet of coevolutionary matrices through deep residual convolutional networks. submitted, 2020. [back to server]