ResPRE result for job RPC6

User Input

>Test (82 residues)
EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIP
MPPNAVSDDEAQTLAKWVLSQK

ResPRE Contact Prediction

The above plot displays the contact-map with a cutoff ≥0.5 of confidence score (ranging from 0 to 1). The full-length contact information for all residue pairs can be downloaded here in CASP RR format: Download contact-map data.

Reference:

Yang Li, Jun Hu, Chengxin Zhang, Dong-Jun Yu, Yang Zhang. ResPRE: high-accuracy protein contact prediction by coupling precision matrix with deep residual neural networks. Bioinformatics, 35: 4647-4655 (2019).

[back to server]