MetaGO result for job id PF14108

User Input

>PF14108 (181 residues)
KIRLDHRWSFIGGSRISVQSNSYTVVHKKFSGVRASWLTTTQIASSVFAVGTTAVLPFYT
LMVVAPKAEITKKCMESSVPYIILGVLYVYLLYISWTPETLKYMFSSKYMLPELSGIAKM
FSSEMTLASAWIHLLVVDLFAARQVYNDGLENQIETRHSVSLCLLFCPVGIVSHFVTKAI
I

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4gbyA	0.47	4.79	0.036	0.746	Download
2	2v0pA	0.46	4.48	0.068	0.713	Download
3	4ldsA	0.46	4.83	0.056	0.729	Download
4	4ufcA	0.46	5.29	0.078	0.784	Download
5	4j05A	0.46	5.19	0.058	0.729	Download
6	3wdoA	0.44	4.70	0.043	0.685	Download
7	2eabA1	0.39	5.47	0.067	0.685	Download
8	4q65A	0.38	5.54	0.027	0.652	Download
9	2pokA1	0.38	5.40	0.032	0.635	Download
10	4zowA1	0.35	5.14	0.035	0.558	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.11	catalytic activity
GO:0016491	0.03	oxidoreductase activity
GO:1901363	0.02	heterocyclic compound binding
GO:0097159	0.02	organic cyclic compound binding
GO:0090484	0.01	drug transporter activity
GO:0050660	0.01	flavin adenine dinucleotide binding
GO:0046914	0.01	transition metal ion binding
GO:0042802	0.01	identical protein binding
GO:0031409	0.01	pigment binding
GO:0022804	0.01	active transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.97	cellular process
GO:0044699	0.90	single-organism process
GO:0008152	0.90	metabolic process
GO:0044237	0.85	cellular metabolic process
GO:0071704	0.76	organic substance metabolic process
GO:0044763	0.74	single-organism cellular process
GO:0044710	0.69	single-organism metabolic process
GO:0044238	0.60	primary metabolic process
GO:0065007	0.55	biological regulation
GO:0009058	0.54	biosynthetic process
GO:0050789	0.47	regulation of biological process
GO:1901576	0.44	organic substance biosynthetic process
GO:0044711	0.44	single-organism biosynthetic process
GO:0044249	0.43	cellular biosynthetic process
GO:0050794	0.40	regulation of cellular process
GO:0044281	0.40	small molecule metabolic process
GO:0019222	0.31	regulation of metabolic process
GO:0031323	0.30	regulation of cellular metabolic process
GO:0006082	0.30	organic acid metabolic process
GO:0019752	0.29	carboxylic acid metabolic process
GO:0006629	0.25	lipid metabolic process
GO:0044255	0.23	cellular lipid metabolic process
GO:0032787	0.22	monocarboxylic acid metabolic process
GO:0044283	0.21	small molecule biosynthetic process
GO:0006720	0.19	isoprenoid metabolic process
GO:0006721	0.18	terpenoid metabolic process
GO:0016116	0.17	carotenoid metabolic process
GO:0016053	0.17	organic acid biosynthetic process
GO:0072330	0.16	monocarboxylic acid biosynthetic process
GO:0016122	0.16	xanthophyll metabolic process
GO:2000377	0.14	regulation of reactive oxygen species metabolic process
GO:0009688	0.14	abscisic acid biosynthetic process
GO:0032928	0.13	regulation of superoxide anion generation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044444	1.00	cytoplasmic part
GO:0044435	0.98	plastid part
GO:0044434	0.97	chloroplast part
GO:0009536	0.91	plastid
GO:0016020	0.89	membrane
GO:0009507	0.81	chloroplast
GO:0009941	0.44	chloroplast envelope
GO:0044436	0.18	thylakoid part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]