MetaGO result for job id PF07627

User Input

>PF07627 (99 residues)
RGGILRHGSILLATSYATRTSPVIRGKWILDNILGVPPPPPPANVPELEETQTGQQALSM
RERLAEHRANPACASCHRLMDPIGFAFENYDAVGRWRTT

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6gctA	0.58	3.09	0.021	0.869	Download
2	3eqxA1	0.57	3.78	0.084	0.939	Download
3	3letA2	0.56	3.82	0.054	0.919	Download
4	4luqA2	0.56	3.74	0.097	0.929	Download
5	3n3uA	0.55	3.60	0.067	0.869	Download
6	2g03A	0.54	4.01	0.057	0.869	Download
7	4rglA1	0.52	3.91	0.076	0.879	Download
8	4x2cA	0.50	4.05	0.086	0.859	Download
9	3shgA	0.50	4.27	0.065	0.899	Download
10	3o59X	0.49	4.39	0.088	0.869	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016772	0.01	transferase activity, transferring phosphorus-containing groups

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071897	0.01	DNA biosynthetic process
GO:0044054	0.01	rounding by symbiont of host cells
GO:0035024	0.01	negative regulation of Rho protein signal transduction
GO:0034260	0.01	negative regulation of GTPase activity
GO:0018178	0.01	peptidyl-threonine adenylylation
GO:0016539	0.01	intein-mediated protein splicing
GO:0009405	0.01	pathogenesis
GO:0006261	0.01	DNA-dependent DNA replication
GO:0000738	0.01	DNA catabolic process, exonucleolytic

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0042597	0.01	periplasmic space

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]