MetaGO result for job id PF07587

User Input

>PF07587 (257 residues)
RLGLAQWLVHPEHPLTARVTVNRMWQHHFGTGLVKTAEDFGVQGEYPSHPALLDWLAVDF
IESGWDVKRLHKLLVMSATYQQSSRVDAAKLAADPENRLLSRGARFRLDAEVIRDQALAV
SGLLVPEIGGKSVRPYQPPGLWKPVGFGGSNTSVFKQDTGDKLYRRSMYTFWKRTSPPPS
MTAFDAPDRETCQVRRARTNTPLQALVLMNDVQFVEAARKFAECVVRQGGSSVEERVTFA
YRSLLSRRPTASELASV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4w8yA1	0.43	6.35	0.061	0.763	Download
2	2btoB	0.42	5.81	0.059	0.693	Download
3	3hkeD	0.42	5.88	0.050	0.689	Download
4	2gahA1	0.42	6.30	0.068	0.728	Download
5	3fdhA	0.34	6.08	0.065	0.572	Download
6	1cefA	0.32	6.33	0.061	0.564	Download
7	2w78A2	0.31	6.17	0.027	0.537	Download
8	3r3sA	0.31	5.87	0.062	0.529	Download
9	1y56A3	0.30	5.84	0.048	0.498	Download
10	3ju8A2	0.29	6.34	0.037	0.537	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.03	purine ribonucleoside triphosphate binding
GO:0032561	0.03	guanyl ribonucleotide binding
GO:0032550	0.03	purine ribonucleoside binding
GO:0017111	0.02	nucleoside-triphosphatase activity
GO:0005198	0.02	structural molecule activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044763	0.02	single-organism cellular process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005874	0.02	microtubule
GO:0005881	0.01	cytoplasmic microtubule
GO:0005876	0.01	spindle microtubule
GO:0005856	0.01	cytoskeleton
GO:0005816	0.01	spindle pole body

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]