MetaGO result for job id PF14319

User Input

>UniRef100_A0A101W133/6-381 (376 residues)
LEVADIFRRHGQAWRAANAQHLSRTQRRVMTAIEICRTAELGGHVERCEDCAHTRIAYNS
CRNRHCPKCQWRAAEAWLEARRAELLPVPYFHVVFTLPAALRPIAYQNKDKVYGLLFKAA
AETLTTIAADKKHLGANIGVTAVLHTWGQNLDHHPHVHCIVPGGGISTEGNRWVSCRPNF
FLPVRVLSRLFRRLFLEGLKRLHVAGDLRFFSDLSELGDTAAFEEFLALQRRTEWVVYAK
EPFAGPKQVLAYLARYTHRVAISNRRLVSLGDDHVHFRWQDYRANGRTKHKIMELTPGEF
MRRFLLHVLPDRFHRIRHYGLFANSHRAQMLARCRELLKQTIDTQPTVENEEQQANAEPP
PCPCCGGRMKIIETFE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4yddA	0.38	7.05	0.028	0.649	Download
2	3ir7A	0.37	6.37	0.031	0.601	Download
3	2eabA	0.37	6.39	0.054	0.585	Download
4	4a01A	0.36	6.59	0.061	0.582	Download
5	1ti4K	0.36	6.81	0.062	0.593	Download
6	1h0hA	0.36	7.17	0.042	0.622	Download
7	1tmoA	0.33	7.01	0.037	0.569	Download
8	2nyaA	0.33	7.26	0.044	0.564	Download
9	1eu1A	0.31	7.08	0.030	0.535	Download
10	2ivfA	0.31	7.08	0.020	0.532	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004803	0.15	transposase activity
GO:0046914	0.07	transition metal ion binding
GO:0051540	0.03	metal cluster binding
GO:0016661	0.02	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0050681	0.01	androgen receptor binding
GO:0046975	0.01	histone methyltransferase activity (H3-K36 specific)
GO:0046966	0.01	thyroid hormone receptor binding
GO:0046965	0.01	retinoid X receptor binding
GO:0042799	0.01	histone methyltransferase activity (H4-K20 specific)
GO:0030331	0.01	estrogen receptor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071704	0.31	organic substance metabolic process
GO:0044237	0.31	cellular metabolic process
GO:0044699	0.25	single-organism process
GO:0044710	0.23	single-organism metabolic process
GO:0006807	0.22	nitrogen compound metabolic process
GO:0044763	0.21	single-organism cellular process
GO:0044260	0.11	cellular macromolecule metabolic process
GO:0044238	0.10	primary metabolic process
GO:0006313	0.08	transposition, DNA-mediated
GO:0071941	0.02	nitrogen cycle metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0042597	0.04	periplasmic space
GO:1990204	0.01	oxidoreductase complex
GO:0061618	0.01	sublamina densa
GO:0035097	0.01	histone methyltransferase complex
GO:0031012	0.01	extracellular matrix
GO:0030288	0.01	outer membrane-bounded periplasmic space

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]