MetaGO result for job id PF14192

User Input

>UniRef100_UPI0003FE4FB0/3-73 (71 residues)
FPSEKTVKRIKAKYPEGTRVELVHMDDPYTKIPEGTLGTVQVVDDTGTIHVKWDNGSSLG
IVYGEDSCRKI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5ftbA	0.67	2.09	0.221	0.845	Download
2	2jngA	0.67	2.27	0.138	0.901	Download
3	2n5uA	0.67	2.11	0.174	0.887	Download
4	4xi6A4	0.66	1.86	0.190	0.817	Download
5	1ireB	0.66	2.39	0.141	0.901	Download
6	2dppB1	0.65	2.60	0.077	0.915	Download
7	2dxcA	0.65	2.43	0.188	0.901	Download
8	4fm4B2	0.62	2.84	0.136	0.873	Download
9	1ahjB	0.62	2.53	0.188	0.845	Download
10	1pguB2	0.48	2.81	0.091	0.704	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046983	0.03	protein dimerization activity
GO:0044877	0.02	macromolecular complex binding
GO:0044822	0.02	poly(A) RNA binding
GO:0042393	0.02	histone binding
GO:0003712	0.02	transcription cofactor activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1903902	0.03	positive regulation of viral life cycle
GO:1900363	0.03	regulation of mRNA polyadenylation
GO:0046782	0.03	regulation of viral transcription
GO:0045893	0.03	positive regulation of transcription, DNA-templated
GO:0045892	0.03	negative regulation of transcription, DNA-templated
GO:0042221	0.03	response to chemical
GO:0039694	0.03	viral RNA genome replication
GO:0032784	0.03	regulation of DNA-templated transcription, elongation
GO:0031441	0.03	negative regulation of mRNA 3'-end processing
GO:0016241	0.03	regulation of macroautophagy

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0035145	0.01	exon-exon junction complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]