MetaGO result for job id PF14119

User Input

>UniRef100_A0A1E8B258/1-118 (118 residues)
MYAVKLLFESVHSGKPNPSKIDEHYEENHDTLFEESIILVKANSLEEAHELGEKIAIQSE
DTYDNMYGEQVTWTFRKVLHVFELNDTSFETGTELYARFLHVKKNEAVDTVVKQYYPE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5xjyA	0.55	4.08	0.017	0.873	Download
2	3cfrA2	0.52	4.15	0.079	0.814	Download
3	4txdA1	0.52	3.75	0.105	0.814	Download
4	3k5nA2	0.52	3.91	0.092	0.771	Download
5	4q5vA2	0.47	4.13	0.092	0.746	Download
6	4fvmA	0.45	4.22	0.105	0.729	Download
7	1qhtA2	0.45	3.93	0.054	0.661	Download
8	1s5jA	0.42	4.78	0.046	0.763	Download
9	1pbuA	0.41	4.31	0.070	0.703	Download
10	2gv9B1	0.40	4.95	0.043	0.771	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901265	0.02	nucleoside phosphate binding
GO:0036094	0.02	small molecule binding
GO:0034061	0.02	DNA polymerase activity
GO:0004518	0.02	nuclease activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044034	0.02	multi-organism biosynthetic process
GO:0034654	0.02	nucleobase-containing compound biosynthetic process
GO:0019079	0.02	viral genome replication
GO:0006261	0.02	DNA-dependent DNA replication

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0061695	0.02	transferase complex, transferring phosphorus-containing groups
GO:0044454	0.02	nuclear chromosome part
GO:0042575	0.01	DNA polymerase complex
GO:0005658	0.01	alpha DNA polymerase:primase complex
GO:0005657	0.01	replication fork

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]