MetaGO result for job id PF14092

User Input

>UniRef100_R5KTH5/10-499 (490 residues)
TIVSAMMFTACDETTDTIGTSLTDNMDMLEVSTDTFELTSKSVVVDSVLSRNTTGYLGKI
KDPETGNYITCDFMAQFGTLEDYELPEIDSIASLSEAFNENDSREDMINKIVADSCHIRL
FYTSYYGDSLATMNMTAYEMSKPMEENKKYYSNFDPKEEYVGNDGMKINKTYTLVDLSIS
DDERADESSYTPNIKINLNQPYTDKNGKTYNNFGTYIMRKYYENPEYFKNSYNFIHNVCP
GFYFEINDGLGSMAYVSVSQLNIYFKYKNDSTYIGTSTFAGTEEVLQTTNIVNDDKSLDN
LAEDNTCTYLKTPSGIFTELTLPVDEVRRGHENDTLNTAKLVLTRLNNKTHSEYALDVPT
TLLMIPSDSINSFFENEDIVDYQRSFIATYDGASSSSAHNYNTYTFDNISGMISSMYNAK
NTGLADNPNWLDEHENWNKVVIIPVSVTTNSSSQIVKVVHDMSLTSTRLVGGSANPNAPI
TLTVVYSKFN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5yz0A	0.41	7.29	0.050	0.673	Download
2	1bxrA	0.39	7.24	0.040	0.637	Download
3	5y81B	0.39	7.00	0.057	0.612	Download
4	5dotA	0.39	7.24	0.062	0.622	Download
5	5h64A	0.38	7.13	0.046	0.620	Download
6	5fvmA	0.38	7.15	0.027	0.616	Download
7	2vdcA	0.38	7.32	0.037	0.618	Download
8	4gnsB	0.38	7.43	0.045	0.635	Download
9	5x7oA	0.37	7.15	0.050	0.602	Download
10	6h02A	0.37	6.68	0.053	0.565	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0032559	0.05	adenyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0043169	0.04	cation binding
GO:0016884	0.02	carbon-nitrogen ligase activity, with glutamine as amido-N-donor

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0043604	0.02	amide biosynthetic process
GO:0019627	0.02	urea metabolic process
GO:0009084	0.02	glutamine family amino acid biosynthetic process
GO:0008652	0.02	cellular amino acid biosynthetic process
GO:0006525	0.02	arginine metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0031966	0.02	mitochondrial membrane
GO:0042645	0.01	mitochondrial nucleoid
GO:0012505	0.01	endomembrane system
GO:0005759	0.01	mitochondrial matrix
GO:0005743	0.01	mitochondrial inner membrane
GO:0005741	0.01	mitochondrial outer membrane
GO:0005739	0.01	mitochondrion
GO:0005730	0.01	nucleolus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]