MetaGO result for job id PF14086

User Input

>24151276/1-90 (90 residues)
MKLLIVEDNPAMQTTLQRTLERRGMQVVLCDDGARALDRWRAAVPDVVLLDLNLPGADGL
EVLAAARAEGLATPVIIVTARGTVGDRVLG

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2zwmA	0.90	1.59	0.307	0.978	Download
2	2v0nA1	0.90	1.55	0.303	0.978	Download
3	1nxwA	0.89	1.73	0.318	0.978	Download
4	1ys6B1	0.89	1.76	0.315	0.989	Download
5	1mvoA	0.89	1.75	0.337	0.989	Download
6	4h60A	0.88	1.62	0.284	0.978	Download
7	3t8yA	0.88	1.34	0.253	0.967	Download
8	6ifhA	0.88	1.89	0.326	0.989	Download
9	3mm4A	0.88	1.43	0.276	0.967	Download
10	2r25B	0.87	1.70	0.281	0.989	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003677	0.26	DNA binding
GO:0004871	0.24	signal transducer activity
GO:0000156	0.20	phosphorelay response regulator activity
GO:0042802	0.14	identical protein binding
GO:0016301	0.06	kinase activity
GO:0004673	0.05	protein histidine kinase activity
GO:0046872	0.04	metal ion binding
GO:0000155	0.04	phosphorelay sensor kinase activity
GO:0001108	0.03	bacterial-type RNA polymerase holo enzyme binding
GO:0009927	0.01	histidine phosphotransfer kinase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0050789	0.73	regulation of biological process
GO:0065007	0.72	biological regulation
GO:0050794	0.70	regulation of cellular process
GO:0007165	0.46	signal transduction
GO:0035556	0.43	intracellular signal transduction
GO:0000160	0.41	phosphorelay signal transduction system
GO:0019222	0.07	regulation of metabolic process
GO:0080090	0.06	regulation of primary metabolic process
GO:0060255	0.06	regulation of macromolecule metabolic process
GO:0051171	0.06	regulation of nitrogen compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005622	0.02	intracellular

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]