MetaGO result for job id PF13886

User Input

>UniRef100_A0A0G4MXI2/104-276 (173 residues)
DLFNATIPEGQLPLQPEITPGWAVSGVLLLLSGSVYTLIGIKNTWLHTFFSTAYLASLGT
AVLIVYVMEPPISSGIQGAYVVAVALTGLILGGVTTFCKEVTEGLGCMLGGFCLSMWLLC
LRPGGLFHASSSKIVFIACLTLGSFAFYFSRYTRDYALIVCIAFSGATVAVLG

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1gpjA	0.53	4.31	0.046	0.809	Download
2	4av3A	0.52	4.81	0.042	0.827	Download
3	4iu8A	0.50	4.35	0.072	0.769	Download
4	4bb9A	0.50	4.66	0.090	0.792	Download
5	4dhdA2	0.49	3.68	0.066	0.653	Download
6	3aqbB2	0.49	3.42	0.053	0.630	Download
7	3k07A	0.49	4.89	0.047	0.769	Download
8	5ncog	0.48	4.83	0.045	0.763	Download
9	3sksA	0.48	4.84	0.053	0.798	Download
10	1wy0A2	0.46	3.94	0.065	0.647	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005261	0.03	cation channel activity
GO:0005096	0.02	GTPase activator activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.07	biological regulation
GO:0044710	0.03	single-organism metabolic process
GO:0009966	0.03	regulation of signal transduction
GO:0090263	0.01	positive regulation of canonical Wnt signaling pathway
GO:0086010	0.01	membrane depolarization during action potential
GO:0046578	0.01	regulation of Ras protein signal transduction
GO:0034220	0.01	ion transmembrane transport
GO:0031578	0.01	mitotic spindle orientation checkpoint
GO:0006816	0.01	calcium ion transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	0.01	extracellular exosome
GO:0009507	0.01	chloroplast

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]