MetaGO result for job id PF13865

User Input

>UniRef100_UPI000333F8DE/1-248 (248 residues)
MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQME
NRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAVGGRGLPIIQRGLPRGALRGG
RATRTLLRGGMSLRGQNLLRGGRAAAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGISGR
GRGIIGRGRGGFGGRGRGRGRGRGALSRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMA
QTDPEAND

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3nvnB	0.45	5.94	0.072	0.766	Download
2	1b25A	0.45	5.96	0.052	0.750	Download
3	3ayfA	0.44	5.68	0.058	0.726	Download
4	2y8nA	0.44	5.78	0.051	0.734	Download
5	6damA	0.43	6.17	0.037	0.766	Download
6	1jqnA	0.43	6.25	0.057	0.774	Download
7	3pflA	0.43	5.91	0.065	0.722	Download
8	6h02A	0.43	6.12	0.044	0.758	Download
9	5i2aA	0.43	5.81	0.033	0.714	Download
10	2nlzD	0.42	5.63	0.043	0.710	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003676	0.98	nucleic acid binding
GO:0003723	0.44	RNA binding
GO:0044822	0.36	poly(A) RNA binding
GO:0003677	0.35	DNA binding
GO:0043565	0.34	sequence-specific DNA binding
GO:0008327	0.31	methyl-CpG binding
GO:0003824	0.05	catalytic activity
GO:0016274	0.04	protein-arginine N-methyltransferase activity
GO:0035242	0.03	protein-arginine omega-N asymmetric methyltransferase activity
GO:0008469	0.03	histone-arginine N-methyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.89	biological regulation
GO:0050789	0.89	regulation of biological process
GO:0050794	0.84	regulation of cellular process
GO:0019222	0.84	regulation of metabolic process
GO:0060255	0.83	regulation of macromolecule metabolic process
GO:0008152	0.82	metabolic process
GO:0080090	0.77	regulation of primary metabolic process
GO:0031323	0.77	regulation of cellular metabolic process
GO:0009987	0.52	cellular process
GO:0044260	0.36	cellular macromolecule metabolic process
GO:0044238	0.35	primary metabolic process
GO:0048518	0.32	positive regulation of biological process
GO:0048522	0.31	positive regulation of cellular process
GO:0009893	0.29	positive regulation of metabolic process
GO:0031325	0.28	positive regulation of cellular metabolic process
GO:0010604	0.28	positive regulation of macromolecule metabolic process
GO:0090304	0.18	nucleic acid metabolic process
GO:0051179	0.18	localization
GO:0032268	0.18	regulation of cellular protein metabolic process
GO:0051649	0.17	establishment of localization in cell
GO:0051641	0.17	cellular localization
GO:0051128	0.17	regulation of cellular component organization
GO:0006810	0.17	transport
GO:0071702	0.16	organic substance transport
GO:0046907	0.16	intracellular transport
GO:0032270	0.15	positive regulation of cellular protein metabolic process
GO:0031399	0.15	regulation of protein modification process
GO:0016070	0.15	RNA metabolic process
GO:0006406	0.15	mRNA export from nucleus
GO:1902275	0.14	regulation of chromatin organization
GO:0051130	0.14	positive regulation of cellular component organization
GO:0044699	0.14	single-organism process
GO:0042127	0.14	regulation of cell proliferation
GO:0031401	0.14	positive regulation of protein modification process
GO:0031062	0.13	positive regulation of histone methylation
GO:0010468	0.13	regulation of gene expression
GO:0008284	0.13	positive regulation of cell proliferation
GO:0051171	0.09	regulation of nitrogen compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044428	1.00	nuclear part
GO:0032991	0.93	macromolecular complex
GO:0043234	0.85	protein complex
GO:0043229	0.59	intracellular organelle
GO:0005654	0.45	nucleoplasm
GO:0043231	0.40	intracellular membrane-bounded organelle
GO:0044451	0.15	nucleoplasm part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]