MetaGO result for job id PF13687

User Input

>UniRef100_UPI00084D4582/17-483 (467 residues)
SRYLAFSISFYCIFAFIPYFYRREGFELYVIKLFTSFFITYLYSVIIYLGLSAMLFSIES
LFSINISEKLYFDIMLIVAGIFAPAFFLADIPEYGEEFHLDSYPKVLKVLLLYILLPMIV
AYSAILYAYFVKILVTRQWPKGIVSNLVLWYSIFSTLIIFFIYPLRNINKWVKTFISYFP
MSLIPLLGMMFVSMIIRINAYGITENRYFVMLVGLWVTGCMIYFIFVKSARNIVLPISLA
LISILSVSGPWSCYSISKLSQNIRFEKILEKNDMIRNGSVIKPNQDLSETDKKEISEIIL
YFNRYHNLRDLKYLPQDFKISQMKNVFGFQLYKGNRGDKKYFNHYALEDGEILNIKGFDY
FTYISSNKFTNTNTSKEDFYILYTSQKRELKIFKQGELIYSRNVEDLAKELHKKYGERDQ
IKMNEMVVAEQNEKVKVLYVFKYIHGFEDRAIDKVNVDSFGFYIFTK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5a22A	0.43	7.61	0.040	0.735	Download
2	4m5dA	0.42	7.22	0.060	0.698	Download
3	5ak1A	0.40	7.68	0.033	0.694	Download
4	6nctA	0.39	7.35	0.038	0.662	Download
5	5opjA	0.39	6.92	0.035	0.621	Download
6	2j5wA	0.39	7.56	0.042	0.668	Download
7	2vsqA	0.39	7.45	0.041	0.655	Download
8	5mqmA	0.38	7.10	0.028	0.623	Download
9	5anbK	0.38	7.09	0.040	0.615	Download
10	6fb3A	0.38	7.63	0.043	0.649	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004935	0.06	adrenergic receptor activity
GO:0051380	0.01	norepinephrine binding
GO:0051379	0.01	epinephrine binding
GO:0046982	0.01	protein heterodimerization activity
GO:0046789	0.01	host cell surface receptor binding
GO:0042803	0.01	protein homodimerization activity
GO:0032795	0.01	heterotrimeric G-protein binding
GO:0031996	0.01	thioesterase binding
GO:0031696	0.01	alpha-2C adrenergic receptor binding
GO:0030165	0.01	PDZ domain binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0050794	0.07	regulation of cellular process
GO:0009987	0.05	cellular process
GO:0007165	0.05	signal transduction
GO:0071880	0.04	adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0044763	0.03	single-organism cellular process
GO:0042592	0.02	homeostatic process
GO:0007267	0.02	cell-cell signaling
GO:1901020	0.01	negative regulation of calcium ion transmembrane transporter activity
GO:0090303	0.01	positive regulation of wound healing
GO:0071883	0.01	activation of MAPK activity by adrenergic receptor signaling pathway

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005887	0.01	integral component of plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]