MetaGO result for job id PF13617

User Input

>UniRef100_A0A085AIJ0/8-63 (56 residues)
LCALAAMMLTGCTPRIEVAAPKEPITINMNVKIEHEIHIKVDKDVENLLKSRSDLF

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1na6B1	0.69	2.32	0.071	1.000	Download
2	5c0wK	0.65	1.71	0.191	0.839	Download
3	3safA1	0.64	1.78	0.085	0.839	Download
4	2hbkA	0.64	1.84	0.188	0.857	Download
5	4nlbA1	0.63	1.90	0.146	0.857	Download
6	3cymA1	0.61	2.56	0.058	0.911	Download
7	1yt3A1	0.59	2.10	0.128	0.839	Download
8	4jvwA	0.47	2.58	0.227	0.714	Download
9	2wl3A	0.46	2.26	0.132	0.696	Download
10	2qfzA2	0.42	3.56	0.071	0.768	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901265	0.02	nucleoside phosphate binding
GO:0036094	0.02	small molecule binding
GO:0016888	0.02	endodeoxyribonuclease activity, producing 5'-phosphomonoesters
GO:0015666	0.02	restriction endodeoxyribonuclease activity
GO:0016896	0.01	exoribonuclease activity, producing 5'-phosphomonoesters

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071047	0.02	polyadenylation-dependent mRNA catabolic process
GO:0071046	0.02	nuclear polyadenylation-dependent ncRNA catabolic process
GO:0071041	0.02	antisense RNA transcript catabolic process
GO:0071034	0.02	CUT catabolic process
GO:0071033	0.02	nuclear retention of pre-mRNA at the site of transcription
GO:0071031	0.02	nuclear mRNA surveillance of mRNA 3'-end processing
GO:0044355	0.02	clearance of foreign intracellular DNA
GO:0034472	0.02	snRNA 3'-end processing
GO:0031126	0.02	snoRNA 3'-end processing
GO:0031125	0.02	rRNA 3'-end processing

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0035327	0.01	transcriptionally active chromatin
GO:0005622	0.01	intracellular
GO:0000176	0.01	nuclear exosome (RNase complex)

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]