MetaGO result for job id PF12367

User Input

>UniRef100_UPI0004716BCD/10-261 (252 residues)
ETAWCPGCGNFNILEALKNALEILGKKPHEVLIVGGIGQAAKTPQYINTNGFCGLHGRAL
PAAVGAKMVNKDLTVIVHTGDGDSYGEGGNHFIHNIRRNVDITHFVHDNQIYGLTKGQAS
PTTDLGHVTEVQVAGNINPPLNPVLLAIALGAGFVARAFSGDKEHLTSIMVEAIKHKGYS
LVDILQPCVSFNKVNTFQWYSKRVYKLDESYDPTDKLKAMEKAMEWGDRIPIGIIYREEK
PTYCDKIEFLRE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1kekA2	0.63	4.35	0.137	0.841	Download
2	5b46B	0.62	4.55	0.298	0.841	Download
3	5c4iC	0.62	4.21	0.147	0.818	Download
4	6cinA	0.62	4.29	0.137	0.821	Download
5	6n2nB	0.61	4.61	0.207	0.837	Download
6	3lq2A	0.56	4.87	0.070	0.786	Download
7	2xt6A4	0.55	3.73	0.095	0.698	Download
8	1r9jB1	0.55	3.29	0.092	0.671	Download
9	2r8oB	0.54	3.36	0.096	0.671	Download
10	1umbC	0.54	3.46	0.137	0.671	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016491	0.80	oxidoreductase activity
GO:0016625	0.10	oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor
GO:0046872	0.06	metal ion binding
GO:0046914	0.05	transition metal ion binding
GO:0051539	0.02	4 iron, 4 sulfur cluster binding
GO:0030976	0.02	thiamine pyrophosphate binding
GO:0016730	0.01	oxidoreductase activity, acting on iron-sulfur proteins as donors

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044710	0.11	single-organism metabolic process
GO:0044763	0.09	single-organism cellular process
GO:0006091	0.08	generation of precursor metabolites and energy
GO:0006082	0.07	organic acid metabolic process
GO:0044711	0.05	single-organism biosynthetic process
GO:0006979	0.05	response to oxidative stress
GO:0006090	0.05	pyruvate metabolic process
GO:0006085	0.05	acetyl-CoA biosynthetic process
GO:0055114	0.04	oxidation-reduction process
GO:0070814	0.01	hydrogen sulfide biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005829	0.02	cytosol
GO:0005618	0.01	cell wall

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]