MetaGO result for job id PF12088

User Input

>96759705/2-75 (74 residues)
AICAAGIREVGVIVGDTRDEIIAAAGDGSRWQAQITYIPQEAPLGLAHAVWTARDFLRDE
PFIMYLGDNLIQHG

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3lzcA	0.68	2.65	0.155	0.960	Download
2	4ix1A2	0.68	2.75	0.123	0.960	Download
3	3jzdA	0.63	3.00	0.101	0.932	Download
4	2xecA	0.62	3.16	0.097	0.973	Download
5	2hqbA	0.61	2.90	0.141	0.946	Download
6	3urmA1	0.58	3.10	0.046	0.824	Download
7	2i2xF	0.56	3.03	0.087	0.838	Download
8	2q9bA	0.52	3.42	0.057	0.919	Download
9	2cb0B2	0.47	3.47	0.056	0.797	Download
10	3rftA	0.47	3.97	0.078	0.851	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016779	0.27	nucleotidyltransferase activity
GO:0043169	0.09	cation binding
GO:0070569	0.02	uridylyltransferase activity
GO:0008879	0.02	glucose-1-phosphate thymidylyltransferase activity
GO:0000287	0.02	magnesium ion binding
GO:0042802	0.01	identical protein binding
GO:0004475	0.01	mannose-1-phosphate guanylyltransferase activity
GO:0003983	0.01	UTP:glucose-1-phosphate uridylyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071704	0.12	organic substance metabolic process
GO:0044238	0.12	primary metabolic process
GO:0044237	0.07	cellular metabolic process
GO:0005975	0.07	carbohydrate metabolic process
GO:0044710	0.06	single-organism metabolic process
GO:0043170	0.06	macromolecule metabolic process
GO:0009058	0.06	biosynthetic process
GO:0044723	0.05	single-organism carbohydrate metabolic process
GO:0044249	0.05	cellular biosynthetic process
GO:1901576	0.04	organic substance biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0071575	0.01	integral component of external side of plasma membrane
GO:0030288	0.01	outer membrane-bounded periplasmic space
GO:0005886	0.01	plasma membrane
GO:0005880	0.01	nuclear microtubule
GO:0005829	0.01	cytosol

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]