MetaGO result for job id PF12040

User Input

>UniRef100_UPI0007838551/4-477 (474 residues)
ILSVARNALRHLLRSRIALTGVVLVALLTLAAAVTSRAYQADQAGLRDRLQHAADQDFAA
QPNRHPHRVVHFGHFAIRPASGLAAMDPGVEAYTGNMIFLEGHRQNSANFGDARQSSLLV
RFGQLSPALVLQAIAPLLLVFIGAGMVAGERERGTLRQSLLAGVSGGTLLGGKALALGVA
GLIISAPAFGLLLWLGVNGGARASAVALSALGYVAYLAFWTLLIVAVSAMVQRSRTALIA
LVGAWAFSVVLVPRLAPEVATGLTPLPTRVETDIAVQRDLRAMGDSHNPNDPYFAAFKQK
MLKQYGVSRVEDLPVNYRGLLAIEGEKLTSSLFDRYADQAFGAMAAQGRVMDALAVVSPT
IAIRRLSMTLAETDLSAYRRFLEQAETYRYDLVQRLNRLQATAVTAEDDAAKSKSAAAEA
RSRISADHWRSMPHFTPDRPSVGEVTGRALPSLIVLLLWLAAGAFLAARAGRRL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5xjyA	0.43	5.78	0.065	0.580	Download
2	5w1hA	0.40	7.15	0.046	0.654	Download
3	4av3A	0.40	6.36	0.081	0.584	Download
4	6gykA	0.38	7.47	0.047	0.627	Download
5	5do7A	0.38	4.54	0.105	0.475	Download
6	5do7B	0.38	4.59	0.112	0.473	Download
7	5nj3A	0.38	4.63	0.080	0.473	Download
8	3ayfA	0.37	7.27	0.048	0.597	Download
9	3ikmD	0.37	7.15	0.044	0.606	Download
10	3dy5A	0.36	6.73	0.055	0.559	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0022857	0.55	transmembrane transporter activity
GO:0015562	0.08	efflux transmembrane transporter activity
GO:0015405	0.08	P-P-bond-hydrolysis-driven transmembrane transporter activity
GO:0016462	0.06	pyrophosphatase activity
GO:0043169	0.02	cation binding
GO:0042626	0.02	ATPase activity, coupled to transmembrane movement of substances

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006810	0.34	transport
GO:0055085	0.05	transmembrane transport
GO:0015672	0.02	monovalent inorganic cation transport
GO:0006818	0.02	hydrogen transport
GO:1902995	0.01	positive regulation of phospholipid efflux
GO:1902430	0.01	negative regulation of beta-amyloid formation
GO:1901076	0.01	positive regulation of engulfment of apoptotic cell
GO:1900223	0.01	positive regulation of beta-amyloid clearance
GO:0070374	0.01	positive regulation of ERK1 and ERK2 cascade
GO:0045727	0.01	positive regulation of translation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0016021	0.04	integral component of membrane
GO:0009380	0.01	excinuclease repair complex
GO:0005887	0.01	integral component of plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]