MetaGO result for job id PF11753

User Input

>41498186/1-94 (94 residues)
AQHEQQSKQSTVHYFTSRFSISECFNSTGKCLATTTGLRLTIRHLSLQDSASTCLSVRSL
PCILANIYSIPFLQRKWYKNPYSRALHITSRHFK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5yf4A	0.57	3.61	0.081	0.894	Download
2	1culC	0.56	3.33	0.048	0.851	Download
3	2rgnA1	0.56	3.37	0.047	0.851	Download
4	1azsC1	0.55	3.36	0.058	0.862	Download
5	1shzA	0.55	3.61	0.095	0.862	Download
6	1tndA1	0.54	3.72	0.068	0.894	Download
7	1cipA1	0.52	3.71	0.080	0.883	Download
8	1zcaA	0.49	4.46	0.023	0.872	Download
9	2xtzA	0.48	4.38	0.045	0.904	Download
10	4fidA	0.47	4.03	0.060	0.851	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0032561	0.05	guanyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0032403	0.05	protein complex binding
GO:0043169	0.04	cation binding
GO:0017111	0.04	nucleoside-triphosphatase activity
GO:0005102	0.03	receptor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0007187	0.05	G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:1904321	0.02	response to forskolin
GO:1902531	0.02	regulation of intracellular signal transduction
GO:1901655	0.02	cellular response to ketone
GO:0071407	0.02	cellular response to organic cyclic compound
GO:0071396	0.02	cellular response to lipid
GO:0050804	0.02	modulation of synaptic transmission
GO:0023057	0.02	negative regulation of signaling
GO:0019933	0.02	cAMP-mediated signaling
GO:0010648	0.02	negative regulation of cell communication

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005834	0.02	heterotrimeric G-protein complex
GO:0005622	0.02	intracellular
GO:0070062	0.01	extracellular exosome
GO:0060170	0.01	ciliary membrane
GO:0045121	0.01	membrane raft
GO:0031526	0.01	brush border membrane
GO:0030496	0.01	midbody
GO:0005929	0.01	cilium
GO:0005886	0.01	plasma membrane
GO:0005856	0.01	cytoskeleton

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]