MetaGO result for job id PF11351

User Input

>UniRef100_B8FC45/5-163 (159 residues)
LTGLGSVADFASSVVNRIFPEKMSEADKAQAQIKLQEMLQQRDDVVINAKRDIMVAEASQ
DDKWTKRARPAIIYCGLAFIFIVHVFFPIVTKSIILGCLIFAPEKLTPEVMAALKSYMDL
SLPTAFWTAWGGAVSIYAIGRTAEKRGVQSKLVSLITGN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1y1uA	0.61	3.84	0.089	0.855	Download
2	1bg1A	0.60	4.28	0.070	0.874	Download
3	3p8cA	0.60	4.20	0.073	0.931	Download
4	1yvlB	0.60	4.25	0.106	0.868	Download
5	5yfpC	0.60	4.43	0.068	0.906	Download
6	2fji1	0.60	4.03	0.047	0.868	Download
7	1uusA	0.54	3.90	0.030	0.786	Download
8	2btpA2	0.51	3.18	0.092	0.685	Download
9	1a38A2	0.50	3.01	0.077	0.654	Download
10	3hhmB	0.40	2.89	0.026	0.509	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0001071	0.04	nucleic acid binding transcription factor activity
GO:0019902	0.03	phosphatase binding
GO:0001046	0.02	core promoter sequence-specific DNA binding
GO:0000987	0.02	core promoter proximal region sequence-specific DNA binding
GO:0000977	0.02	RNA polymerase II regulatory region sequence-specific DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0045893	0.04	positive regulation of transcription, DNA-templated
GO:0006357	0.04	regulation of transcription from RNA polymerase II promoter
GO:0097696	0.03	STAT cascade
GO:0034097	0.03	response to cytokine
GO:0014070	0.03	response to organic cyclic compound
GO:0060396	0.02	growth hormone receptor signaling pathway
GO:0051239	0.02	regulation of multicellular organismal process
GO:0048638	0.02	regulation of developmental growth
GO:0043069	0.02	negative regulation of programmed cell death
GO:0042981	0.02	regulation of apoptotic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005829	0.01	cytosol
GO:0005654	0.01	nucleoplasm
GO:0000790	0.01	nuclear chromatin

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]