MetaGO result for job id PF11304

User Input

>UniRef100_A0A1Q7G3E2/1-312 (312 residues)
MARRLAGHLRVLALIFLLGLAGLETAWGQTPGPGLENLTPEERAVAERNLERWQRMTPEE
RQRAVENYRRWKSMTPEEREAARETFRRFRQLPPEERARILRDIQHWNELPAQRRQELQQ
AYERFQRLPPEGRERILERLRQYESLPPEERERITRNWERWRKMTPEERQRAVENYRRWK
SMTPEEREAARETFRRFRQLPPEERARILRDIQHWNELPAQRRQELQQAYERFQRLPPEG
RERILERLRQYESLPPEERERITRNWERWRKMTPEERQQLRERWQHMTPEEREQLRERHR
QEPGGRSDRPRP

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4wz9A	0.43	6.37	0.041	0.708	Download
2	5zvs2	0.43	6.79	0.035	0.747	Download
3	3ayfA	0.42	6.71	0.035	0.753	Download
4	5ak1A	0.42	6.50	0.042	0.712	Download
5	5n4aA	0.42	5.88	0.033	0.651	Download
6	2vdcA	0.42	6.26	0.056	0.686	Download
7	2ccdA	0.42	6.05	0.035	0.676	Download
8	6ar6A	0.42	6.89	0.050	0.756	Download
9	5tubA	0.42	5.17	0.052	0.625	Download
10	1itkB	0.41	6.38	0.050	0.696	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016787	0.12	hydrolase activity
GO:0046914	0.04	transition metal ion binding
GO:0046906	0.04	tetrapyrrole binding
GO:0016676	0.04	oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor
GO:0016662	0.04	oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor
GO:0015078	0.04	hydrogen ion transmembrane transporter activity
GO:0015002	0.04	heme-copper terminal oxidase activity
GO:0009055	0.04	electron carrier activity
GO:0003774	0.04	motor activity
GO:0016887	0.03	ATPase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.32	single-organism process
GO:0044763	0.26	single-organism cellular process
GO:0051179	0.16	localization
GO:0006810	0.15	transport
GO:0044765	0.05	single-organism transport
GO:0098662	0.04	inorganic cation transmembrane transport
GO:0071941	0.04	nitrogen cycle metabolic process
GO:0045333	0.04	cellular respiration
GO:0019538	0.04	protein metabolic process
GO:0015992	0.04	proton transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005886	0.02	plasma membrane
GO:0070469	0.01	respiratory chain
GO:0070062	0.01	extracellular exosome
GO:0005871	0.01	kinesin complex
GO:0005788	0.01	endoplasmic reticulum lumen
GO:0005765	0.01	lysosomal membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]