MetaGO result for job id PF11227

User Input

>UniRef100_UPI000932F10A/9-260 (252 residues)
PWFEAVAAHGQSALTCDDWRLALSTQAAAARVVTGQGQPLRFVAQETLPVATAYEAFIAA
TGGVPTRRNLHDFFNALIWLTFPRAKAALNARQARAIATDGVQATRGATRDAATLFDENA
VLFACSEPSLGEALRGFDWHTLFVTRRADWGRTCEVQPFGHALLEKLVSPYKSVTAHAWI
IDVPHDYFDAPPMHRRQWLDERIAPQLVSAPLSTRDFAPLPVLGIPGWWPANADPAFYRD
ASVFRPGRREKS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1ltuA	0.46	4.64	0.131	0.659	Download
2	4bptA	0.46	4.71	0.084	0.647	Download
3	2v27B	0.45	4.74	0.062	0.643	Download
4	5jk5A	0.45	4.14	0.068	0.607	Download
5	2phmA	0.45	4.30	0.050	0.611	Download
6	2tohA	0.45	4.21	0.051	0.607	Download
7	3e2tA	0.43	4.61	0.057	0.615	Download
8	1g8xA1	0.29	6.31	0.022	0.524	Download
9	2qmxA2	0.26	6.47	0.061	0.484	Download
10	2dykA	0.24	4.97	0.092	0.357	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046914	0.05	transition metal ion binding
GO:0016705	0.05	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	0.05	monooxygenase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1901360	0.04	organic cyclic compound metabolic process
GO:0006725	0.04	cellular aromatic compound metabolic process
GO:0009063	0.02	cellular amino acid catabolic process
GO:0006558	0.02	L-phenylalanine metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0043005	0.01	neuron projection

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]