MetaGO result for job id PF11220

User Input

>UniRef100_UPI000309DA72/1-148 (148 residues)
MKRILLGTLLATASLSALADAPGSDGCGWGNMLFKGQRGTATHVLAATTNGTSGNNTFGM
TTGTNGCHTNGALTYGGKPMIVLSSMMDELSEDMAKGDGEALTTYAVVLGVKPEDRAHFA
QVTHEHFAQIFNKADVTAEDVYANTQAV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2q06A	0.51	4.80	0.083	0.851	Download
2	5yfbA	0.51	4.82	0.075	0.851	Download
3	5aexA	0.50	4.59	0.055	0.804	Download
4	1qfxB	0.50	4.66	0.094	0.797	Download
5	1b1yA	0.50	4.97	0.051	0.885	Download
6	3wcaA	0.49	4.49	0.050	0.804	Download
7	3tj0A	0.49	4.40	0.049	0.770	Download
8	1sk9A	0.49	4.62	0.058	0.777	Download
9	3b9zA	0.49	4.78	0.056	0.818	Download
10	1fa2A	0.49	5.25	0.072	0.892	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0008519	0.01	ammonium transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0075732	0.01	viral penetration into host nucleus
GO:0072488	0.01	ammonium transmembrane transport
GO:0046718	0.01	viral entry into host cell
GO:0016311	0.01	dephosphorylation
GO:0000272	0.01	polysaccharide catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0042025	0.01	host cell nucleus
GO:0019029	0.01	helical viral capsid
GO:0019013	0.01	viral nucleocapsid
GO:0019012	0.01	virion
GO:0005576	0.01	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]