MetaGO result for job id PF11146

User Input

>UniRef100_A0A0S2T9Y6/1-66 (66 residues)
MQKLLITIGVVLIVLGVLWPLLQKSGLGRLPGDIAVEKENFKFYFPITTSIIVSIVLSLI
LWFFMR

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1y2mB	0.68	2.62	0.091	0.864	Download
2	4av3A3	0.66	2.80	0.091	0.909	Download
3	1jqnA1	0.66	2.39	0.078	0.833	Download
4	2x58A	0.66	3.43	0.094	0.955	Download
5	6iumB3	0.65	3.07	0.065	0.909	Download
6	5tp4A1	0.65	3.15	0.033	0.894	Download
7	1zcjA2	0.64	3.50	0.094	0.924	Download
8	3d4sA1	0.64	2.61	0.036	0.833	Download
9	3pqaA2	0.63	2.24	0.063	0.879	Download
10	3t2bA1	0.63	2.98	0.113	0.894	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0015075	0.29	ion transmembrane transporter activity
GO:0008381	0.11	mechanically-gated ion channel activity
GO:0031420	0.02	alkali metal ion binding
GO:0016863	0.02	intramolecular oxidoreductase activity, transposing C=C bonds
GO:0016836	0.02	hydro-lyase activity
GO:0016616	0.02	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046983	0.01	protein dimerization activity
GO:0046873	0.01	metal ion transmembrane transporter activity
GO:0042802	0.01	identical protein binding
GO:0016462	0.01	pyrophosphatase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006811	0.18	ion transport
GO:0006820	0.06	anion transport
GO:0098662	0.02	inorganic cation transmembrane transport
GO:0030001	0.02	metal ion transport
GO:0019395	0.02	fatty acid oxidation
GO:0015672	0.02	monovalent inorganic cation transport
GO:0009062	0.02	fatty acid catabolic process
GO:0006818	0.02	hydrogen transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005886	0.02	plasma membrane
GO:0005777	0.01	peroxisome
GO:0005618	0.01	cell wall

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]