MetaGO result for job id PF10985

User Input

>104173552/5-66 (62 residues)
KNSWSFYQLSQFITYKAQRQGIRVEQVDPAYTSQECPACKARNKAQDRNYVCVECGWMGH
RD

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3fpvA	0.56	3.01	0.071	0.871	Download
2	6bwsA	0.55	3.01	0.088	0.871	Download
3	5viuA1	0.55	3.14	0.070	0.855	Download
4	5cx7A	0.55	3.06	0.123	0.871	Download
5	1sffA1	0.54	3.43	0.086	0.871	Download
6	2a2lA	0.54	3.19	0.068	0.855	Download
7	2zsmA1	0.54	3.52	0.100	0.887	Download
8	2a7uB	0.54	3.42	0.066	0.871	Download
9	2bylA1	0.52	3.23	0.103	0.855	Download
10	4nkpA	0.51	2.94	0.057	0.806	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016740	0.07	transferase activity
GO:0016773	0.03	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.03	kinase activity
GO:0004674	0.02	protein serine/threonine kinase activity
GO:0042802	0.01	identical protein binding
GO:0042800	0.01	histone methyltransferase activity (H3-K4 specific)
GO:0030170	0.01	pyridoxal phosphate binding
GO:0000285	0.01	1-phosphatidylinositol-3-phosphate 5-kinase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.06	cellular process
GO:0018193	0.05	peptidyl-amino acid modification
GO:0050794	0.04	regulation of cellular process
GO:0071840	0.03	cellular component organization or biogenesis
GO:0080090	0.02	regulation of primary metabolic process
GO:0060255	0.02	regulation of macromolecule metabolic process
GO:0035556	0.02	intracellular signal transduction
GO:0031323	0.02	regulation of cellular metabolic process
GO:0018105	0.02	peptidyl-serine phosphorylation
GO:0016043	0.02	cellular component organization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005829	0.01	cytosol
GO:0005739	0.01	mitochondrion
GO:0005618	0.01	cell wall

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]