MetaGO result for job id PF10975

User Input

>UniRef100_A0A073KMR3/5-132 (128 residues)
FLIAALVYVIACLGLVLYLQKQLSKLRSKVEALTVLVKEGDRQREGFKREMQELRSGTIG
MGRRVIELEKRLHQQSERIEESTQQDPQAKLYTRAMKMVALGAGVDELIKECELPKAEAE
LLIRLHRK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5n6xA	0.71	3.78	0.079	0.969	Download
2	1y1uA	0.67	2.22	0.068	0.805	Download
3	1bg1A	0.67	2.52	0.087	0.812	Download
4	1yvlB	0.64	2.53	0.079	0.797	Download
5	1uusA	0.54	3.28	0.059	0.703	Download
6	1g8pA1	0.37	5.29	0.090	0.695	Download
7	2blmA	0.35	4.73	0.013	0.609	Download
8	4qkwA	0.35	1.75	0.020	0.375	Download
9	2izvA	0.34	4.47	0.040	0.570	Download
10	2ptkA1	0.27	5.20	0.048	0.523	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0019902	0.02	phosphatase binding
GO:0005198	0.02	structural molecule activity
GO:0004871	0.02	signal transducer activity
GO:0003676	0.02	nucleic acid binding
GO:0001071	0.02	nucleic acid binding transcription factor activity
GO:0098641	0.01	cadherin binding involved in cell-cell adhesion
GO:0046332	0.01	SMAD binding
GO:0043130	0.01	ubiquitin binding
GO:0022891	0.01	substrate-specific transmembrane transporter activity
GO:0017111	0.01	nucleoside-triphosphatase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.51	cellular process
GO:0065007	0.41	biological regulation
GO:0050789	0.36	regulation of biological process
GO:0050794	0.35	regulation of cellular process
GO:0044699	0.34	single-organism process
GO:0048519	0.10	negative regulation of biological process
GO:0048523	0.09	negative regulation of cellular process
GO:0080090	0.07	regulation of primary metabolic process
GO:0060255	0.07	regulation of macromolecule metabolic process
GO:0051171	0.07	regulation of nitrogen compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0016020	0.70	membrane
GO:0005829	0.24	cytosol
GO:0005886	0.22	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]