MetaGO result for job id PF10755

User Input

>UniRef100_UPI0008100571/9-193 (185 residues)
SRPRSFKWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQHLADWYTPS
HIIHGFLFYGLAWLLFRKKPLSMRLSFAVLIEAAWEILENSPLIIDRYRTATMALGYTGD
SILNSAMDTVFMALGFLFAARVPVWLTVAIAIFFEIFTGWLIRDNLTLNVVMLVWPVEAI
KQWQN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4f4cA	0.49	4.92	0.037	0.789	Download
2	2ww9A2	0.49	3.69	0.051	0.654	Download
3	6a69A	0.49	4.90	0.099	0.778	Download
4	2wwbA2	0.47	4.02	0.074	0.665	Download
5	3mp7A2	0.46	3.56	0.076	0.595	Download
6	3wmeA	0.38	4.70	0.068	0.584	Download
7	3b5wA	0.38	4.36	0.089	0.557	Download
8	3qf4A	0.37	4.48	0.079	0.535	Download
9	2onjA1	0.36	5.20	0.058	0.600	Download
10	2jafA	0.35	4.96	0.022	0.584	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.65	catalytic activity
GO:0005215	0.26	transporter activity
GO:0022857	0.19	transmembrane transporter activity
GO:0016787	0.13	hydrolase activity
GO:0036094	0.10	small molecule binding
GO:0017111	0.09	nucleoside-triphosphatase activity
GO:0000166	0.09	nucleotide binding
GO:0016820	0.08	hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0015405	0.08	P-P-bond-hydrolysis-driven transmembrane transporter activity
GO:0043492	0.07	ATPase activity, coupled to movement of substances

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.77	cellular process
GO:0044699	0.56	single-organism process
GO:0044763	0.32	single-organism cellular process
GO:0006810	0.24	transport
GO:0008152	0.15	metabolic process
GO:0044765	0.13	single-organism transport
GO:0071704	0.10	organic substance metabolic process
GO:0044237	0.10	cellular metabolic process
GO:0044238	0.05	primary metabolic process
GO:0006807	0.04	nitrogen compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.94	cell part
GO:0016020	0.87	membrane
GO:0005886	0.48	plasma membrane
GO:0031224	0.16	intrinsic component of membrane
GO:0016021	0.14	integral component of membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]