MetaGO result for job id PF10115

User Input

>UniRef100_A0A166AHC9/1-93 (93 residues)
MGFFSRLFGGKEKTEQKVEIEPVEYKGFNIYQDAIAESGQYRVAGRIEKEIDGELKTHRF
IRSDVVSNKEDANELMLKKSQMFIDQMGDSIFS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4kmaA	0.63	3.37	0.034	0.957	Download
2	4bl8A	0.62	3.45	0.034	0.957	Download
3	1iznB	0.62	3.49	0.088	0.925	Download
4	4akrB	0.61	3.62	0.067	0.968	Download
5	2cqtA1	0.60	3.78	0.056	0.957	Download
6	1m1lA	0.59	3.17	0.062	0.871	Download
7	3u1wA	0.54	3.48	0.041	0.785	Download
8	1iv9A	0.47	2.77	0.097	0.667	Download
9	1v7vA	0.46	3.67	0.036	0.720	Download
10	3qdeA	0.46	3.61	0.087	0.710	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005215	0.11	transporter activity
GO:0022857	0.06	transmembrane transporter activity
GO:0003824	0.05	catalytic activity
GO:0022891	0.03	substrate-specific transmembrane transporter activity
GO:1901682	0.01	sulfur compound transmembrane transporter activity
GO:0051287	0.01	NAD binding
GO:0051119	0.01	sugar transmembrane transporter activity
GO:0050661	0.01	NADP binding
GO:0046943	0.01	carboxylic acid transmembrane transporter activity
GO:0042626	0.01	ATPase activity, coupled to transmembrane movement of substances

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0051179	0.16	localization
GO:0006810	0.15	transport
GO:0044699	0.14	single-organism process
GO:0009987	0.10	cellular process
GO:0008152	0.05	metabolic process
GO:0071704	0.04	organic substance metabolic process
GO:0044763	0.04	single-organism cellular process
GO:0044237	0.04	cellular metabolic process
GO:0065007	0.03	biological regulation
GO:0044765	0.03	single-organism transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.93	cell part
GO:0016020	0.73	membrane
GO:0005886	0.48	plasma membrane
GO:0042597	0.07	periplasmic space

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]