MetaGO result for job id PF09932

User Input

>UniRef100_R9PFS4/1-80 (80 residues)
MSKIEFSSEQKTALVNKIQGYCEQQLDIEIGQFDAEFLLDFFSEEIGAFYYNQGLQDAQA
VVQNRIDSIADELYEIEKPT

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3ixzA	0.62	3.25	0.064	0.963	Download
2	4i1mA	0.62	2.79	0.075	0.875	Download
3	5fnoA	0.61	2.93	0.038	0.963	Download
4	4a1fA	0.61	2.29	0.097	0.762	Download
5	4jw1A2	0.61	2.94	0.075	0.875	Download
6	1no3A	0.58	2.97	0.090	0.912	Download
7	3dy5A3	0.56	2.83	0.051	0.850	Download
8	2p0mA2	0.52	3.53	0.056	0.875	Download
9	3o8yA	0.51	4.16	0.077	0.925	Download
10	4jvsA1	0.49	3.91	0.067	0.863	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.03	purine ribonucleoside triphosphate binding
GO:0032559	0.03	adenyl ribonucleotide binding
GO:0032550	0.03	purine ribonucleoside binding
GO:0031420	0.02	alkali metal ion binding
GO:0015081	0.02	sodium ion transmembrane transporter activity
GO:0008556	0.02	potassium-transporting ATPase activity
GO:0019899	0.01	enzyme binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0098739	0.02	import across plasma membrane
GO:0090662	0.02	ATP hydrolysis coupled transmembrane transport
GO:0071805	0.02	potassium ion transmembrane transport
GO:0071436	0.02	sodium ion export
GO:0055078	0.02	sodium ion homeostasis
GO:0055075	0.02	potassium ion homeostasis
GO:0042391	0.02	regulation of membrane potential
GO:0030004	0.02	cellular monovalent inorganic cation homeostasis
GO:0015988	0.02	energy coupled proton transmembrane transport, against electrochemical gradient
GO:0010959	0.02	regulation of metal ion transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0016021	0.01	integral component of membrane
GO:0005886	0.01	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]