MetaGO result for job id PF09350

User Input

>k87_21047949_3_1/1-96 (96 residues)
MSLLDQLAEARIQKAQQEGAFDDLPGRGKPIELDDDSMIPEALRAGYRLLKNAGYLPPEL
QLQREIREVEDLLAQTQEAAERSVFEKRLRLLRARL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5n2uA	0.52	4.46	0.054	0.917	Download
2	5llmA2	0.52	4.05	0.011	0.875	Download
3	1a6eA2	0.51	4.21	0.089	0.875	Download
4	1nthA	0.51	3.90	0.118	0.865	Download
5	3v7nA	0.51	4.20	0.071	0.875	Download
6	6fijA1	0.51	3.71	0.082	0.844	Download
7	4k80A	0.51	3.63	0.038	0.781	Download
8	4djiA	0.51	3.79	0.063	0.833	Download
9	2ynjA	0.47	4.75	0.087	0.917	Download
10	1iokA	0.47	4.83	0.120	0.927	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0032559	0.05	adenyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0008134	0.02	transcription factor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.31	cellular process
GO:0048213	0.13	Golgi vesicle prefusion complex stabilization
GO:0007030	0.13	Golgi organization
GO:0006890	0.13	retrograde vesicle-mediated transport, Golgi to ER
GO:0000301	0.13	retrograde transport, vesicle recycling within Golgi
GO:0045944	0.01	positive regulation of transcription from RNA polymerase II promoter
GO:0043044	0.01	ATP-dependent chromatin remodeling
GO:0007399	0.01	nervous system development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0043234	0.05	protein complex
GO:0017119	0.04	Golgi transport complex
GO:0005832	0.03	chaperonin-containing T-complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]