MetaGO result for job id PF08734

User Input

>UniRef100_A0A0S7XVW2/1-95 (95 residues)
MATYIMLLRFTEQGIKNIKESPARVEAAKQAARGMGAEVKEFYAVIGQYDTVVVVEAPDD
ETVASMALALGSLGNVRTETLRAFTEDEYRKIIAA

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3k5nA2	0.64	3.27	0.069	0.895	Download
2	5zliA2	0.64	3.49	0.086	0.937	Download
3	1umgA	0.63	3.11	0.101	0.905	Download
4	4fvmA	0.63	3.42	0.091	0.916	Download
5	4q5vA	0.63	3.43	0.068	0.916	Download
6	6hr7A	0.63	3.42	0.074	0.958	Download
7	3fkyC	0.63	3.37	0.096	0.926	Download
8	3t2bA	0.63	3.17	0.112	0.905	Download
9	2d3bA2	0.63	3.55	0.128	0.937	Download
10	2uu7O2	0.63	3.39	0.096	0.926	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.04	purine ribonucleoside triphosphate binding
GO:0032559	0.04	adenyl ribonucleotide binding
GO:0032550	0.04	purine ribonucleoside binding
GO:0016531	0.02	copper chaperone activity
GO:0015662	0.02	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
GO:0008047	0.02	enzyme activator activity
GO:0005375	0.02	copper ion transmembrane transporter activity
GO:0072509	0.01	divalent inorganic cation transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0000041	0.04	transition metal ion transport
GO:0098662	0.02	inorganic cation transmembrane transport
GO:0072511	0.02	divalent inorganic cation transport
GO:0071369	0.02	cellular response to ethylene stimulus
GO:0050790	0.02	regulation of catalytic activity
GO:0050787	0.02	detoxification of mercury ion
GO:0044093	0.02	positive regulation of molecular function
GO:0010118	0.02	stomatal movement
GO:0009755	0.02	hormone-mediated signaling pathway
GO:0000160	0.02	phosphorelay signal transduction system

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0048471	0.01	perinuclear region of cytoplasm
GO:0043025	0.01	neuronal cell body
GO:0043005	0.01	neuron projection
GO:0031526	0.01	brush border membrane
GO:0030141	0.01	secretory granule
GO:0030140	0.01	trans-Golgi network transport vesicle
GO:0016323	0.01	basolateral plasma membrane
GO:0005887	0.01	integral component of plasma membrane
GO:0005802	0.01	trans-Golgi network
GO:0005794	0.01	Golgi apparatus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]