MetaGO result for job id PF08592

User Input

>UniRef100_N4XCJ6/5-215 (211 residues)
QALQILSISTALIASGGISAFSLFSIPMLKSQPASRSLPMVRWLFSRGSHVFPTAGILSS
TSFLLLTYLSLPPSTSSLQILFRAASHGQPAYFLAASVLCISIAPITSFLMIPTNFTLIR
MNEELGGTRSEKSAEWRSERGSGARSADASVDGEEDVSQWKDLSPPQEKTARQSSEKEDI
EVRALLEKFSRLNALRAVAIGAGGVVGLMGV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2j0oA	0.63	4.46	0.073	0.900	Download
2	4ui9I	0.59	3.92	0.069	0.787	Download
3	1z7qp	0.59	3.92	0.065	0.796	Download
4	2izpA	0.58	4.71	0.062	0.829	Download
5	2p7nA	0.58	4.96	0.055	0.853	Download
6	3nzzA	0.55	3.92	0.087	0.754	Download
7	1avoN	0.47	3.23	0.068	0.597	Download
8	1fr0A	0.37	3.48	0.085	0.488	Download
9	3u24A	0.37	5.44	0.033	0.607	Download
10	2ivzD	0.34	6.25	0.031	0.640	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term

Cscore^GO

Name

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.07	metabolic process
GO:0044699	0.05	single-organism process
GO:0071704	0.04	organic substance metabolic process
GO:0044763	0.03	single-organism cellular process
GO:0044550	0.03	secondary metabolite biosynthetic process
GO:1903050	0.02	regulation of proteolysis involved in cellular protein catabolic process
GO:0046189	0.02	phenol-containing compound biosynthetic process
GO:0042181	0.02	ketone biosynthetic process
GO:0010498	0.02	proteasomal protein catabolic process
GO:0009405	0.02	pathogenesis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005739	0.02	mitochondrion
GO:0008537	0.01	proteasome activator complex
GO:0005680	0.01	anaphase-promoting complex
GO:0005654	0.01	nucleoplasm
GO:0005576	0.01	extracellular region
GO:0000502	0.01	proteasome complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]