MetaGO result for job id PF07583

User Input

>42392762/1-288 (288 residues)
YRRTEGGSYTEIGRTSGKTYSDTISAGIKYYYAVAVYSGSRTEDKCPEVGVMYLATPSGL
SVTNTIASLTLKWNAVTGATGYEVYRAGTDGKYSKITTVTSTSYVDTNVKNNTQYSYRIK
AYNAAYTSAFSTAASLKKTQISVSNLKADATGSKVQLSWTGGVTGAEGYVIYRRTEGGSY
TEIGRTSGKTYSDTISAGKKYYYAVAVYSGSRTEDKCPEVGAMYLAEPAVTGASNITSGV
QVKWSQVTGATGYIVYRKGAGKGWARIADIKDGSTVNYTDTTAASGTT

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5mz9A	0.42	6.18	0.047	0.715	Download
2	4pkcA	0.41	6.15	0.041	0.681	Download
3	5kf6A	0.41	6.53	0.040	0.722	Download
4	7r1rA	0.41	6.55	0.066	0.726	Download
5	1h7aA	0.40	5.94	0.045	0.667	Download
6	2r7oA1	0.32	6.78	0.051	0.597	Download
7	3aw5A	0.32	6.72	0.035	0.590	Download
8	2pffA1	0.32	6.93	0.044	0.594	Download
9	1w78A1	0.31	6.38	0.049	0.528	Download
10	3iv9A	0.29	6.38	0.026	0.507	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0097367	0.06	carbohydrate derivative binding
GO:0061731	0.05	ribonucleoside-diphosphate reductase activity
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0032559	0.05	adenyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0042802	0.02	identical protein binding
GO:0097493	0.01	structural molecule activity conferring elasticity
GO:0051371	0.01	muscle alpha-actinin binding
GO:0051015	0.01	actin filament binding
GO:0042803	0.01	protein homodimerization activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.30	cellular process
GO:0044699	0.19	single-organism process
GO:0044763	0.17	single-organism cellular process
GO:0043170	0.09	macromolecule metabolic process
GO:0044260	0.06	cellular macromolecule metabolic process
GO:0044238	0.06	primary metabolic process
GO:0032502	0.05	developmental process
GO:0044767	0.04	single-organism developmental process
GO:0034645	0.04	cellular macromolecule biosynthetic process
GO:0006259	0.04	DNA metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005971	0.02	ribonucleoside-diphosphate reductase complex
GO:0070062	0.01	extracellular exosome
GO:0043025	0.01	neuronal cell body
GO:0030425	0.01	dendrite
GO:0030424	0.01	axon
GO:0019012	0.01	virion
GO:0005635	0.01	nuclear envelope

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]