MetaGO result for job id PF04087

User Input

>k87_19841792_2_1/31-465 (435 residues)
PHLIERLQIRDLADPESTIEGIKKDIEFRGFNLWILVFSIVIASIGLNVDSTAIVIGAML
ISPLMGPIMGFGLGVGINDAGMVRKSLTNLGVAVSIAVLSSAIYFFISPIDEASNELFAR
TNPTFLDVLVALFGGLTGILAGSRKEKSNVIPGVAIATALMPPLCTAGFGLANGQWDYFF
GAFYLFLINVILIATATSLVVRYLNFPQATYVDPVRERKYKRYFAVALLALVIPSGWIFY
KTVSETVVTSRINGYVVEHAKFPGTEVVKSEIVWMSGAPHVHLVLLGEFVPQPLVDQWKE
GLTKVVPDADMHVVQNTKDATGLAEMNRLIDLYSEGREALALREDEIRSLREELASTTAQ
LSGLQLPPSLGVEIQLQHPAVLGARMGLLRATDSEGTTPWIQVLWAPRTDSTSWDEEDEQ
RIESWLRVRLGNPAA

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6fhjA	0.41	7.16	0.045	0.683	Download
2	5kf6A	0.40	7.27	0.055	0.685	Download
3	2x2hA	0.40	6.99	0.059	0.664	Download
4	4bxsV	0.40	7.12	0.085	0.671	Download
5	2j5wA	0.40	7.30	0.070	0.671	Download
6	2amvA	0.40	7.42	0.046	0.671	Download
7	1ut9A	0.39	6.66	0.024	0.625	Download
8	4ff1A	0.39	7.43	0.040	0.674	Download
9	5dgqA	0.39	6.64	0.033	0.621	Download
10	3h7lA	0.39	6.74	0.033	0.628	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046914	0.02	transition metal ion binding
GO:0019901	0.02	protein kinase binding
GO:0022857	0.01	transmembrane transporter activity
GO:0003917	0.01	DNA topoisomerase type I activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.12	single-organism process
GO:0044763	0.11	single-organism cellular process
GO:0022008	0.09	neurogenesis
GO:0071901	0.01	negative regulation of protein serine/threonine kinase activity
GO:0055114	0.01	oxidation-reduction process
GO:0055085	0.01	transmembrane transport
GO:0046688	0.01	response to copper ion
GO:0044469	0.01	envenomation resulting in positive regulation of blood coagulation in other organism
GO:0044351	0.01	macropinocytosis
GO:0035807	0.01	positive regulation of blood coagulation in other organism

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005576	0.03	extracellular region
GO:0031988	0.02	membrane-bounded vesicle
GO:0070062	0.01	extracellular exosome
GO:0033116	0.01	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0031093	0.01	platelet alpha granule lumen
GO:0030134	0.01	ER to Golgi transport vesicle
GO:0005886	0.01	plasma membrane
GO:0005813	0.01	centrosome
GO:0005788	0.01	endoplasmic reticulum lumen
GO:0005615	0.01	extracellular space

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]