MetaGO result for job id PF03837

User Input

>UniRef100_M8CU30/22-242 (221 residues)
KKGKTIFDLIREMEPAIKKALPKQISVDRFSRIVMTAVRTNPKLQTCTSESFLAAMMQSA
QLGLEPNTPLGQAYLIPYGKEVQFQLGYQGMLALAYRTGEYKSIYAMPVYKNDKFEYEYG
LNERLVHVPAPKPEGEPIYYYAVYHLKNGGYGFVVMSREQIEQHRDKYSQAAKQGRNSPW
NTDFDAMAKKTVLKQLLKYAPKSAEFAAALSADETVKKEIA

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6b6lA	0.45	5.24	0.054	0.720	Download
2	5aezA	0.45	6.09	0.075	0.837	Download
3	5aexA	0.45	6.07	0.070	0.828	Download
4	2yevA	0.45	5.38	0.053	0.733	Download
5	6eu6A	0.45	6.26	0.055	0.842	Download
6	1l1lA	0.44	5.36	0.068	0.729	Download
7	2nuuD	0.44	6.14	0.066	0.815	Download
8	3b9zA	0.42	6.17	0.035	0.792	Download
9	3o0rB	0.34	6.48	0.034	0.665	Download
10	4mruA	0.33	7.03	0.045	0.692	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.74	heterocyclic compound binding
GO:0097159	0.73	organic cyclic compound binding
GO:0003697	0.30	single-stranded DNA binding
GO:0016676	0.06	oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor
GO:0015002	0.06	heme-copper terminal oxidase activity
GO:0046914	0.05	transition metal ion binding
GO:0046906	0.05	tetrapyrrole binding
GO:0015078	0.05	hydrogen ion transmembrane transporter activity
GO:0009055	0.05	electron carrier activity
GO:0016662	0.03	oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044237	0.52	cellular metabolic process
GO:0006807	0.41	nitrogen compound metabolic process
GO:0043150	0.13	DNA synthesis involved in double-strand break repair via homologous recombination
GO:0032508	0.13	DNA duplex unwinding
GO:0098662	0.05	inorganic cation transmembrane transport
GO:0045333	0.05	cellular respiration
GO:0015992	0.05	proton transport
GO:0071941	0.03	nitrogen cycle metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0032993	0.04	protein-DNA complex
GO:0070469	0.01	respiratory chain
GO:0016021	0.01	integral component of membrane
GO:0005886	0.01	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]