MetaGO result for job id PF03682

User Input

>UniRef100_UPI000509CCCE/1-384 (384 residues)
MCANKMKQEAQNPLILRCHRLMEAFAKSDDERDFYIDRLEGFLIYIDLDKPQAELDALQE
ELEQNADRYCQIPKLSFYETKKIMEGFVNEKVYDIDTKEKLLDIIQSKEARENFLEFIYD
HHAEQEKWQQFYQERSRIRIIEWLRLNHFHFVFEEDLDLPRPLVEKLKHSLFQTKVGKDI
LTARKNLFAKAKTYYSNEALNPRPKRGRPPKQAAKPDIEPQVTIDIFTTVPPTVRPFLFT
PDLQASHFSAFSSKFDSEEDLLASRRQSFDTDASFSQKLASLRSLSSRWLEPEPSSEKNP
YAMDNSFNDDDDDDDDDFDDDFSDKKSKKAKAAKPKAKTPAKAAKAAVKAAKPEKPKTKR
IMPKVKKETAPTKTKGLKKIIPKK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5m59A	0.42	6.89	0.085	0.716	Download
2	4f91B	0.42	7.01	0.049	0.719	Download
3	4bgdA	0.42	6.88	0.043	0.695	Download
4	1itkB	0.41	6.89	0.057	0.677	Download
5	4d0jA	0.41	6.73	0.036	0.672	Download
6	4iibA	0.40	6.85	0.044	0.677	Download
7	2fxhA	0.40	6.71	0.053	0.656	Download
8	2ccdA	0.40	6.81	0.062	0.659	Download
9	5whqA	0.40	6.80	0.046	0.654	Download
10	5nbsA	0.40	6.60	0.037	0.643	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.04	heterocyclic compound binding
GO:0097159	0.04	organic cyclic compound binding
GO:0035639	0.03	purine ribonucleoside triphosphate binding
GO:0032559	0.03	adenyl ribonucleotide binding
GO:0032550	0.03	purine ribonucleoside binding
GO:0051015	0.01	actin filament binding
GO:0046982	0.01	protein heterodimerization activity
GO:0043140	0.01	ATP-dependent 3'-5' DNA helicase activity
GO:0042803	0.01	protein homodimerization activity
GO:0030507	0.01	spectrin binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.06	cellular process
GO:0016043	0.04	cellular component organization
GO:0044763	0.02	single-organism cellular process
GO:0006461	0.02	protein complex assembly
GO:2000042	0.01	negative regulation of double-strand break repair via homologous recombination
GO:0098910	0.01	regulation of atrial cardiac muscle cell action potential
GO:0097681	0.01	double-strand break repair via alternative nonhomologous end joining
GO:0072661	0.01	protein targeting to plasma membrane
GO:0071425	0.01	hematopoietic stem cell proliferation
GO:0060047	0.01	heart contraction

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0043232	0.03	intracellular non-membrane-bounded organelle
GO:0043590	0.01	bacterial nucleoid
GO:0031499	0.01	TRAMP complex
GO:0005730	0.01	nucleolus
GO:0005694	0.01	chromosome
GO:0005622	0.01	intracellular

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]