MetaGO result for job id PF00839

User Input

>UniRef100_UPI00051C5BFD/3-37 (35 residues)
EAVCREDVVRLCSKHSWANNLAVLECLQDVREPDN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2w69B	0.71	1.87	0.029	0.943	Download
2	4wrtA2	0.71	2.16	0.000	1.000	Download
3	4wsbA2	0.70	2.25	0.029	1.000	Download
4	5d98A	0.59	1.68	0.065	0.886	Download
5	3pyaA2	0.52	2.60	0.031	0.914	Download
6	2v57B	0.50	2.77	0.000	0.829	Download
7	1d0nA1	0.46	2.82	0.061	0.800	Download
8	4cczA5	0.44	3.37	0.063	0.743	Download
9	3apzA1	0.44	2.84	0.091	0.800	Download
10	1vw4F	0.43	3.02	0.032	0.800	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0017134	0.30	fibroblast growth factor binding
GO:0034062	0.03	RNA polymerase activity
GO:0003676	0.02	nucleic acid binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.08	cellular process
GO:0097659	0.04	nucleic acid-templated transcription
GO:0034645	0.04	cellular macromolecule biosynthetic process
GO:0010467	0.04	gene expression
GO:0044699	0.03	single-organism process
GO:0060349	0.02	bone morphogenesis
GO:0050900	0.02	leukocyte migration
GO:0032330	0.02	regulation of chondrocyte differentiation
GO:0030512	0.02	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0010955	0.02	negative regulation of protein processing

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0000139	0.04	Golgi membrane
GO:0042025	0.01	host cell nucleus
GO:0031904	0.01	endosome lumen
GO:0030430	0.01	host cell cytoplasm
GO:0005654	0.01	nucleoplasm
GO:0005576	0.01	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]