MUSTER results

MUSTER (MUlti-Source ThreadER) results

> MBD ,91 residues, "Easy" target

Your submitted sequence and predicted secondary structure (by PSI-PRED):

Seq:	MKAPRVRVFRVEGMDCADCARKVASALEEVPGVVGVQVNYASGKAYLVLEREEALREAEA
SS :	CCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEEEECCEEEEEECCCCCHHHHHH
Pos:	123456789012345678901234567890123456789012345678901234567890

Seq:	RLAPLGYRLLQAEGEGEGLPGPWPWALLSGG
SS :	HHHHHCCEEEECCCCCCCCCCCHHHHHHHCC
Pos:	1234567890123456789012345678901

For detailed information about output, please see readme file.

Models generated by MUSTER

MUSTER is a MUlti-Source ThreadER program,which considers six different sources: (1) sequence-derived profiles; (2) secondary structures; (3) structured-derived profiles; (4) solvent accessibility; (5) torsion angles( psi and phi angles); (6) hydrophobic scoring matrix. The optimized threading is found by global dynamic programming.

Rank	Template	Align_length	Coverage	Zscore	Seq_id	Type	Target-template alignments	3-D models from threading alignments	Full-length models by MODELLER
1	1p6tA2	79	0.868	17.805	0.228	Good	alignment_1	threading_1	model_1
2	1fvsA	72	0.791	17.703	0.153	Good	alignment_2	threading_2	model_2
3	1yjtA	74	0.813	17.411	0.284	Good	alignment_3	threading_3	model_3
4	2gcfA	73	0.802	17.403	0.288	Good	alignment_4	threading_4	model_4
5	2kt2A	69	0.758	17.163	0.362	Good	alignment_5	threading_5	model_5
6	3dxsX	73	0.802	17.149	0.247	Good	alignment_6	threading_6	model_6
7	1mwzA	73	0.802	17.007	0.329	Good	alignment_7	threading_7	model_7
8	1y3kA	76	0.835	16.957	0.197	Good	alignment_8	threading_8	model_8
9	2ew9A1	71	0.780	16.772	0.282	Good	alignment_9	threading_9	model_9
10	1kvjA	75	0.824	16.707	0.173	Good	alignment_10	threading_10	model_10

Reference: S. Wu, Y. Zhang. MUSTER: Improving protein sequence profile-profile alignments by using multiple sources of structure information. Proteins: Structure, Function, and Bioinformatics 2008; 72: 547-556