[back]

COFACTOR result for job id 76641

[Download result.tar.bz2 for all prediction results]

User Input

>76641 (248 residues)
MKKKVIFGNWKMNGTNESLTDFLNQVDNKIDSSKIIAGLAVPYVMLQTGLKLAKNVKIAA
QNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITP
IICCGETLQTKESGKTIEFVNNQINIMFEGIKKEDAIKAIIAYEPIWAIGTEKTSTSSDA
EEVCKQIRNNLAKIYDKNTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLASDY
LGLVNYNE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4y8fA	0.98	0.61	0.472	0.992	Download
2	3gvgA	0.98	0.91	0.347	1.000	Download
3	4y9aA	0.98	0.95	0.389	0.996	Download
4	1b9bB	0.97	1.00	0.445	0.996	Download
5	3m9yA	0.97	0.80	0.449	0.988	Download
6	1m6jA	0.97	0.95	0.401	0.996	Download
7	4y96A	0.97	1.18	0.367	1.000	Download
8	2btmA	0.97	1.16	0.474	0.996	Download
9	4g1kA	0.96	0.85	0.361	0.984	Download
10	4obtA	0.96	0.97	0.363	0.988	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004807	1.00	triose-phosphate isomerase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1901576	1.00	organic substance biosynthetic process
GO:0006096	1.00	glycolytic process
GO:0044249	0.99	cellular biosynthetic process
GO:0006094	0.99	gluconeogenesis
GO:0046166	0.98	glyceraldehyde-3-phosphate biosynthetic process
GO:0019563	0.98	glycerol catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044444	1.00	cytoplasmic part
GO:0005829	0.99	cytosol
GO:0005737	0.63	cytoplasm

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.626	2i9eB	0.960	1.03	0.388	0.988	5.3.1.1	9,11,92,164,170
2	0.608	1sq7A	0.966	0.93	0.363	0.988	5.3.1.1	9,11,92,164
3	0.599	1m6jA	0.971	0.95	0.401	0.996	5.3.1.1	9,11,92,164,170
4	0.592	1htiA	0.961	1.02	0.355	0.988	5.3.1.1	9,11,92,164,170
5	0.574	1i45A	0.962	1.01	0.359	0.988	5.3.1.1	9,11,92,164

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.79	1btmB	0.969	1.13	0.462	0.996	1.57	PGA	Download	9,11,92,164,209,210,229,231,232
2	0.54	1yyaA	0.958	1.40	0.391	1.000	1.42	PO4	Download	169,210,231,232
3	0.53	1o5xA	0.949	1.21	0.377	0.984	1.56	3PY	Download	9,11,92,93,208,229,231
4	0.52	1m7pB	0.948	1.22	0.377	0.984	1.30	G3H	Download	11,92,229,231,232
5	0.46	2x1rA	0.875	1.55	0.310	0.923	1.41	X1R	Download	92,164,169,170,209,210
6	0.45	2y6zA	0.888	1.89	0.298	0.960	1.44	TPS	Download	9,89,90,91,92,93,123,164,168,210,229,230,231,232
7	0.44	1tre0	0.967	1.09	0.425	0.996	1.56	III	Download	9,11,12,13,14,15,16,42,43,44,45,47,50,51,61,66,68,69,70,71,72,73,74,79,82,83,92,94,95,98,99

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]