[back]

COFACTOR result for job id 76635

[Download result.tar.bz2 for all prediction results]

User Input

>76635 (318 residues)
MLVSFIIASQAHLDRLKTTVDSIKHQTNNSHQTIIISDSKYTDNTKRQYIKEIFDNSENI
VLSENNIPQDTATDWNCAMQLANGKYVVFVKEGDFLYPNFVEEIQKISDQHNADLIEFNQ
NYNGLVDDQISYNLLEANKLYDLNKDYEVFAYIQRLIYTKAFKLDIIRKNNLTFRRKVRF
DHLFTYKFLSYSDTCYISDDYLSLHRISVMKYSAFDLLRQWPHIINYFRQINKYKLLSDQ
LTYAHYYQTCYKFLDLIEKYNNPVLYKKALNITENKLKNKINRFVKKNKVFLENKDTKFN
QRMNDFERFIYSELKKIK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6h1jA	0.91	1.43	0.181	0.940	Download
2	5tz8A	0.89	1.67	0.134	0.940	Download
3	5heaA	0.73	3.01	0.145	0.833	Download
4	6e4qA	0.68	4.42	0.072	0.871	Download
5	6iwqA	0.68	4.17	0.074	0.846	Download
6	4hg6A	0.67	3.70	0.088	0.827	Download
7	2d7rA	0.67	4.21	0.075	0.830	Download
8	1xhbA	0.66	3.83	0.068	0.808	Download
9	5nqaA	0.66	4.23	0.087	0.824	Download
10	4fixA	0.65	3.92	0.056	0.821	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016740	1.00	transferase activity
GO:0016757	0.97	transferase activity, transferring glycosyl groups
GO:0016758	0.52	transferase activity, transferring hexosyl groups

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	1.00	cellular process
GO:0044763	0.97	single-organism cellular process
GO:0071704	0.94	organic substance metabolic process
GO:0044238	0.94	primary metabolic process
GO:0044237	0.93	cellular metabolic process
GO:0043170	0.89	macromolecule metabolic process
GO:0044710	0.87	single-organism metabolic process
GO:0044260	0.87	cellular macromolecule metabolic process
GO:0044723	0.84	single-organism carbohydrate metabolic process
GO:0044267	0.83	cellular protein metabolic process
GO:0043412	0.83	macromolecule modification
GO:0006464	0.82	cellular protein modification process
GO:0006486	0.81	protein glycosylation
GO:1901576	0.72	organic substance biosynthetic process
GO:0044249	0.72	cellular biosynthetic process
GO:0044711	0.67	single-organism biosynthetic process
GO:1901135	0.66	carbohydrate derivative metabolic process
GO:0044281	0.65	small molecule metabolic process
GO:0006629	0.65	lipid metabolic process
GO:1901137	0.63	carbohydrate derivative biosynthetic process
GO:0044255	0.63	cellular lipid metabolic process
GO:0008610	0.62	lipid biosynthetic process
GO:0046467	0.61	membrane lipid biosynthetic process
GO:0090407	0.60	organophosphate biosynthetic process
GO:0006796	0.60	phosphate-containing compound metabolic process
GO:0006493	0.60	protein O-linked glycosylation
GO:0009247	0.59	glycolipid biosynthetic process
GO:0006487	0.58	protein N-linked glycosylation
GO:0035269	0.57	protein O-linked mannosylation
GO:0019348	0.57	dolichol metabolic process
GO:0006506	0.57	GPI anchor biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0016020	0.99	membrane
GO:0044424	0.93	intracellular part
GO:0044425	0.92	membrane part
GO:0044444	0.86	cytoplasmic part
GO:0044446	0.77	intracellular organelle part
GO:0016021	0.71	integral component of membrane
GO:0043229	0.67	intracellular organelle
GO:0043227	0.67	membrane-bounded organelle
GO:0043231	0.66	intracellular membrane-bounded organelle
GO:0005886	0.66	plasma membrane
GO:0005789	0.60	endoplasmic reticulum membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.066	1on8A	0.527	3.89	0.079	0.660	2.4.1.223	NA
2	0.066	1fggA	0.507	3.16	0.066	0.591	2.4.1.135	NA
3	0.066	3hl3A	0.476	3.90	0.051	0.607	2.7.7.24	15
4	0.060	2icyB	0.465	4.42	0.057	0.604	2.7.7.9	NA
5	0.060	2d0jC	0.506	3.17	0.072	0.591	2.4.1.135	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.15	2z86B	0.645	3.39	0.120	0.758	0.82	UGA	Download	8,9,10,38,68,70,71,74,91,92,93,180,181,206

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]