[back]

COFACTOR result for job id 76563

[Download result.tar.bz2 for all prediction results]

User Input

>76563 (591 residues)
MAKEKIIGIDLGTTNSVVSVIEGGQPIILENPEGQRTTPSVVAFKNSDIIVGGAAKRQAV
TNPNVVQSIKSKMGTTSKVNLEGKDYSPEQISAEILRYMKNYAEAKLGQKVTKAVITVPA
YFNDAQRKATKDAGTIAGLQVERIINEPTAAALAYGLDKQDKEETILVYDLGGGTFDVSI
LAIGGGSFDVIATSGNNKLGGDNFDEEIIKWLLGKIKAEYNIDLSKEKMALQRLKDEAEK
AKINLSSQLEVEINLPFIAMNESGPISFATTLTRSEFNKITKHLVDLTIQPVKDALSAAK
KTPSEINEVLLVGGSTRIPAVQELVKSLLNKEPNRSINPDEVVAMGAAVQGGVLAGEVTD
ILLLDVTPLSLGIETMGGVMTKLIERNTTIPAKRTQIFSTATDNQPAVDINVLQGERAMA
ADNKSLGQFQLTGIQPAPRGIPQIEVTFEIDANGIVSVSAKDKNTNEEKTITISNSGNLS
EAEVERMIKEAQENAANDEVKKKNIELKNKAENYINIIETSLLQAGDKISAEQKEQSQKM
VDEIKELVKNENYEALEQKMAELEQAMAQAAEFANKQNESDPNNNSSEQNN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5e84A	0.93	1.52	0.483	0.956	Download
2	5tkyA	0.90	2.17	0.423	0.949	Download
3	3c7nA	0.81	4.10	0.218	0.932	Download
4	5obuA	0.57	2.33	0.438	0.606	Download
5	6gfaA	0.57	1.22	0.327	0.579	Download
6	4j8fA	0.57	3.09	0.379	0.621	Download
7	2v7yA	0.56	2.46	0.458	0.602	Download
8	1yuwA	0.56	4.11	0.378	0.646	Download
9	3iucC	0.55	2.52	0.501	0.594	Download
10	4kboA	0.55	2.39	0.534	0.589	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.88	catalytic activity
GO:1901363	0.71	heterocyclic compound binding
GO:0097159	0.71	organic cyclic compound binding
GO:0016787	0.71	hydrolase activity
GO:0017111	0.66	nucleoside-triphosphatase activity
GO:0016887	0.64	ATPase activity
GO:0097367	0.62	carbohydrate derivative binding
GO:0000166	0.62	nucleotide binding
GO:0017076	0.61	purine nucleotide binding
GO:0035639	0.60	purine ribonucleoside triphosphate binding
GO:0032555	0.60	purine ribonucleotide binding
GO:0030554	0.60	adenyl nucleotide binding
GO:0051082	0.59	unfolded protein binding
GO:0005524	0.59	ATP binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.92	cellular process
GO:0050896	0.86	response to stimulus
GO:0006950	0.84	response to stress
GO:0008152	0.81	metabolic process
GO:0071704	0.80	organic substance metabolic process
GO:0044237	0.78	cellular metabolic process
GO:0044238	0.77	primary metabolic process
GO:0009628	0.74	response to abiotic stimulus
GO:0006807	0.74	nitrogen compound metabolic process
GO:0009266	0.71	response to temperature stimulus
GO:0009408	0.70	response to heat
GO:0034641	0.69	cellular nitrogen compound metabolic process
GO:0043170	0.68	macromolecule metabolic process
GO:1901360	0.62	organic cyclic compound metabolic process
GO:0046483	0.61	heterocycle metabolic process
GO:0006725	0.61	cellular aromatic compound metabolic process
GO:0065007	0.60	biological regulation
GO:0006139	0.60	nucleobase-containing compound metabolic process
GO:0044260	0.58	cellular macromolecule metabolic process
GO:0042221	0.58	response to chemical
GO:1901576	0.57	organic substance biosynthetic process
GO:0050789	0.57	regulation of biological process
GO:0044249	0.57	cellular biosynthetic process
GO:0050794	0.56	regulation of cellular process
GO:0044699	0.54	single-organism process
GO:0090304	0.53	nucleic acid metabolic process
GO:0071840	0.51	cellular component organization or biogenesis
GO:0051716	0.51	cellular response to stimulus
GO:0016043	0.50	cellular component organization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0044444	0.93	cytoplasmic part
GO:0043226	0.91	organelle
GO:0043229	0.90	intracellular organelle
GO:0043227	0.88	membrane-bounded organelle
GO:0043231	0.86	intracellular membrane-bounded organelle
GO:0032991	0.79	macromolecular complex
GO:0005737	0.73	cytoplasm
GO:0044446	0.72	intracellular organelle part
GO:0005829	0.66	cytosol
GO:0005634	0.61	nucleus
GO:0016020	0.52	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2uytA	0.371	4.43	0.088	0.447	2.7.1.5	16,172,197,313,341
2	0.060	1b0pA	0.342	7.61	0.058	0.546	1.2.7.1	99
3	0.060	1v4tA	0.301	4.81	0.071	0.372	2.7.1.2 2.7.1.1	NA
4	0.060	2iirJ	0.347	4.82	0.112	0.435	2.7.2.1	NA
5	0.060	3b8aX	0.411	4.55	0.101	0.506	2.7.1.1	16

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.75	3iucA	0.550	2.35	0.509	0.589	1.25	ADP	Download	12,13,14,15,172,173,201,239,242,243,313,314,315,317,318
2	0.49	3ldpA	0.550	2.46	0.509	0.592	0.98	3P1	Download	15,173,201,242,314,317,318,340
3	0.26	3i33A	0.549	2.38	0.500	0.589	1.72	PO4	Download	12,13,70,119,147,175
4	0.07	1dkg2	0.538	2.86	0.534	0.592	0.94	III	Download	30,33,50,54,57,58,60,61,105,106,107,108

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]