[back]

COFACTOR result for job id 76518

[Download result.tar.bz2 for all prediction results]

User Input

>76518 (187 residues)
MNKTLLRKQLLEKRKNFDLDYKNTSNLIITNKVIDFIKQHQFKQICIFLSTKYEIETRNI
INWCLNHHILVFVPKITTNNNMNMVLLDNSYLTNFNKFNIQEPTSNILANLKEIDCVFTP
VVGFDNKLNRIGMGKGFYDKFFSLNSFSYLKVGLCFDKQKVDQIIIESNDIKLDYIITEN
QNIYKLN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2jcbA	0.96	0.81	0.272	0.984	Download
2	3hy6A	0.92	1.24	0.291	0.957	Download
3	1souA	0.90	1.66	0.235	0.979	Download
4	1ydmB	0.85	2.22	0.213	0.941	Download
5	1wkcA	0.81	1.82	0.170	0.882	Download
6	1sbqA	0.79	1.88	0.265	0.866	Download
7	1g2iA	0.41	4.38	0.065	0.594	Download
8	2jfgA	0.39	5.17	0.076	0.642	Download
9	3r2wA	0.35	6.06	0.024	0.690	Download
10	2j5wA2	0.32	5.78	0.045	0.588	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0030272	1.00	5-formyltetrahydrofolate cyclo-ligase activity
GO:1901363	0.93	heterocyclic compound binding
GO:0097159	0.93	organic cyclic compound binding
GO:0036094	0.93	small molecule binding
GO:0005524	0.92	ATP binding
GO:0043167	0.90	ion binding
GO:0046872	0.89	metal ion binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1901564	1.00	organonitrogen compound metabolic process
GO:1901360	1.00	organic cyclic compound metabolic process
GO:0046483	1.00	heterocycle metabolic process
GO:0044699	1.00	single-organism process
GO:0034641	1.00	cellular nitrogen compound metabolic process
GO:0006725	1.00	cellular aromatic compound metabolic process
GO:0035999	0.99	tetrahydrofolate interconversion
GO:0009396	0.99	folic acid-containing compound biosynthetic process
GO:0044238	0.66	primary metabolic process
GO:0019752	0.57	carboxylic acid metabolic process
GO:1901575	0.51	organic substance catabolic process
GO:0044248	0.50	cellular catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0044444	0.99	cytoplasmic part
GO:0043229	0.98	intracellular organelle
GO:0043231	0.97	intracellular membrane-bounded organelle
GO:0005739	0.95	mitochondrion
GO:0005737	0.80	cytoplasm
GO:0005829	0.52	cytosol

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.606	2jcbA	0.962	0.81	0.272	0.984	6.3.3.2	130
2	0.593	3hy6A	0.916	1.24	0.291	0.957	6.3.3.2	130
3	0.569	1souA	0.900	1.66	0.235	0.979	6.3.3.2	130
4	0.568	1sbqA	0.793	1.88	0.265	0.866	6.3.3.2	130
5	0.417	1u3fA	0.804	1.74	0.265	0.866	6.3.3.2	74,120,124,139,151,174,176

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.62	3hy4A	0.898	1.29	0.284	0.941	1.49	PO4	Download	130,132,133,134,135,136,137,138,139
2	0.33	3hy3A	0.906	1.25	0.288	0.947	0.96	10F	Download	48,49,51,54,74,76,133,134,135,137
3	0.19	2jcbA	0.962	0.81	0.272	0.984	1.29	ADP	Download	3,7,132,133,134,135,136,139,140,169,170

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]