[back]

COFACTOR result for job id 76501

[Download result.tar.bz2 for all prediction results]

User Input

>76501 (376 residues)
MRKIKESDNKTKKQFKHFFTNKKSLLFLNLCVLFIVSIWIWTFVSIKSNLINIGGSASAD
LVLQKLIKEYQKQTNKKFNYSSTGSGAGARNVINQTYSIGFISKSQNDLSIPKEIRNNLY
DDLTEFEKINDELSKKQVFNHLKTFKDKYHYIDFVKDSIVFVYNIKNTGLTNQQIDQIRF
NVLNNKISSDSQKALHKIYTNNKQSDLISWKEFYKLLTNKDENNISSLIKVRPYSTNSGS
GTRSSFEQISGLKDNNKKIGQAVNEYNSNGAIFTQLDASDGSFGFVSMQYAQDLKKYPNL
RSVIIKQNNQEWNLNKRNDNLLTYPLSRPFVALYKFTDNQKLNDDILDFVYWFSYSNDQK
VKKIYDHLGLIRKVSN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4ombA	0.70	2.05	0.163	0.750	Download
2	1pc3A	0.64	3.08	0.142	0.739	Download
3	4lvqA	0.61	3.03	0.131	0.707	Download
4	1a55A	0.61	3.12	0.191	0.707	Download
5	5i84A	0.60	3.16	0.166	0.702	Download
6	5wnnA	0.60	3.22	0.184	0.705	Download
7	4jwoA	0.59	3.05	0.158	0.692	Download
8	2v3qA	0.59	3.66	0.123	0.710	Download
9	5jk4A	0.58	3.58	0.116	0.697	Download
10	4gd5A	0.58	2.41	0.213	0.636	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0042301	0.97	phosphate ion binding
GO:0022804	0.97	active transmembrane transporter activity
GO:0042626	0.96	ATPase activity, coupled to transmembrane movement of substances
GO:0015103	0.96	inorganic anion transmembrane transporter activity
GO:0015114	0.95	phosphate ion transmembrane transporter activity
GO:0015415	0.94	phosphate ion transmembrane-transporting ATPase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006810	0.99	transport
GO:0006817	0.98	phosphate ion transport
GO:0044763	0.94	single-organism cellular process
GO:0009267	0.93	cellular response to starvation
GO:0016036	0.88	cellular response to phosphate starvation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0005886	0.96	plasma membrane
GO:0043190	0.53	ATP-binding cassette (ABC) transporter complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2gejA	0.381	6.00	0.049	0.582	2.4.1.57	55,64,291
2	0.060	2db3A	0.397	6.03	0.030	0.609	3.6.4.13	90,112
3	0.060	3cmmC	0.416	6.16	0.043	0.649	6.3.2.19	84,86,105,110
4	0.060	2thiA	0.497	4.87	0.090	0.673	2.5.1.2	NA
5	0.060	1v8bC	0.398	6.61	0.059	0.652	3.3.1.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.20	1ixiA	0.608	3.15	0.187	0.707	0.86	2HP	Download	56,57,58,84,85,104,240,241,242
	2	0.01	2owsA	0.479	4.47	0.037	0.630	0.75	OXL	Download	55,59,84,85,86

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]